ELF>6@7 @8 @@@@hhM!M!hh   @8^` ` `  DDPtdЌ Ќ Ќ QtdRtd   00/lib64/ld-linux-x86-64.so.2GNUo!|ܶ3AGNU7@!MXEJp'7:>?ABCDFHIJKf4?*=箈7&C@Ho8q 'bh<}'#V,;ʫ_/}VemgUa9i+d#ț.S).WW  "M\^!`78KIM%&K,8WQ`,CYe {-A=nY9i]( Iad+Z=:&i!PD+ IgJ @5V']M0B]^ ' X%M}0Y,WF%"LT$2`3"/FuZ,) kOH@:k>.1[X zKRT41=y/ %l\?H3]3/;[:CDLXC86E \v:YaQ+a* 41PTX-6- *9$G!$ 0GBM`3'[);961&x,>6 uK _PPV;= &Z%HQ\M-8_$9d.Y_(*`_C'ER4=Tf_JAkEIPH J S~I)-%_U`H:S6V<!^(Q<CU1D%K^BZ6/[Y7 _?_*&,r\TW?WG8Mi:#>A/SM"D D8J2  )G a,R+s_@QV*a;OL8Xs$H)2,W D:R@(!B_1**Zm4HvBm" ^?FZA92|=^EJ]]\Q<L,#$_XG9k&B@`Hg^N DEZEC3&K1_]&aR58 *?5aT[F?^(BL;`,hAJ+Va`\M72% !\&L>_I/B! ``7  # W 28< .Bb;v3P.v%] Ni8>$ 1&FC [4 @ULt2P0 9S@a7}LQ[a[=;)Z \b[$b`Ua_Gf3^V6>&RU\\1qBe6]#`=+\,  0^E"O>C[7RHHGFu(+aZ^SntQq]<?t5F;("6f5 HHE`^ J*s[zSkU^6\6 ~O^'W1N$Cy |z$*2SX>'J@"].Vx)P] ST2]]{?W7PcWj'4%^)ED_ ,?|`71lZ"~"wMn?"#BaXJB7{_5Xu< Z^P([W\10Ln _IULOa]~RVI%?O9=NPG_(?0C88Ia6 -['F#6.^> >B3 -Q.JH'U$F]f3QFx eV\EK`'18v1-7(2Q9B _r%uY6'M[y7_)[xD=<Q&Qa]!G-,`PP:M0A<X;K`U>OfP81F8 WmX :3mL!u3GW.N)VSU[K(/^KY#<@O(L__3M7`T]XVIp "(g,5'FNZYV p*/2wH9CR7<.Xh/ ;ANQDDZ@79IO!<xC ;<M(>E Y+H[MY.9:GS;'\ )&- /U>#TqH4nPZ%M?eMIa "'Ww+#<_>RN;L,h<+2-OR7HlGR"eN+JX&^;JwNGC_TWK<.z] D K&5fbB'i9I-T?A_1"3RNSS#4Z+K{9a$";X`%+ C4I?G{'9M.NNf,B-q-N +s;B,Ra)_L^r R-8!#LOOMrWS1 ;>[Z@.=-a]  FO(XHVR DBfRv_YSP3A:>K;C\UIu?2~EIL9Y/@'3":T\(JGFrGX ?i I`Rx6(K5_2 |8B`Z0n`V*RPEFdp^VG@d0qKTaGIT@SJ7 `jB^2>&_I2C&>HI[\^L[ 8%F)I qX_K1633%wGN*)5@BcL.\L*$Wa8Q#St/L/8P4n(A7j 85N8!V k 8A;^U`k 8=,ik 8[S{40|a"_E  '  N[`E __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTableSSL_SESSION_set1_master_keySSL_CTX_sess_set_remove_cbSSL_select_next_protoSSL_write_early_dataSSL_CONF_CTX_set_ssl_ctxSSL_get_srp_gOPENSSL_cipher_named2i_SSL_SESSIONSSL_CTX_set0_security_ex_dataSSL_get_fdSSL_CTX_set_alpn_select_cbSSL_CTX_set_default_verify_fileSSL_get_verify_resultSSL_CTX_set_srp_client_pwd_callbackSSL_CTX_use_certificate_fileSSL_get_servernameSSL_set_srp_server_paramSSL_writeSSL_CTX_set_default_read_buffer_lenSSL_load_client_CA_fileSSL_ct_is_enabledSSL_set_shutdownSSL_set_connect_stateSSL_SESSION_get0_cipherSSL_CTX_set_tlsext_max_fragment_lengthSSL_shutdownSSL_CTX_set_info_callbackSSL_get_certificateSSL_CTX_set_srp_verify_param_callbackSSL_CTX_set_tlsext_use_srtpSSL_CTX_use_psk_identity_hintSSL_dane_set_flagsSSL_CTX_set_cert_cbSSL_CTX_set_ciphersuitesSSL_CTX_set_keylog_callbackSSL_CTX_dane_enableSSL_CTX_set_psk_find_session_callbackSSL_key_updateSSL_get_servername_typeSSL_get_sessionSSL_set_SSL_CTXSSL_SESSION_printSSL_CTX_newSSL_SESSION_print_keylogSSL_acceptSSL_clearSSL_is_init_finishedSSL_dane_enableSSL_get0_peernameSSL_CTX_sess_set_get_cbSSL_statelessSSL_CTX_set_cookie_verify_cbSSL_CIPHER_findSSL_set_verifySSL_CONF_CTX_set_flagsSSL_CTX_set1_paramSSL_get_shared_sigalgsSSL_CONF_cmdSSL_CTX_set_recv_max_early_dataSSL_CTX_get_cert_storeSSL_CTX_callback_ctrlSSL_CIPHER_standard_nameSSL_get_current_expansionSSL_export_keying_materialSSL_CIPHER_get_handshake_digestSSL_CTX_set_default_ctlog_list_fileSSL_readSSL_SESSION_set_cipherSSL_session_reusedOPENSSL_init_sslSSL_get_selected_srtp_profilePEM_write_bio_SSL_SESSIONSSL_SESSION_get0_peerSSL_has_pendingDTLSv1_listenSSL_get0_alpn_selectedSSL_CTX_use_PrivateKeySSL_CTX_add_client_custom_extSSL_CTX_enable_ctSSL_CTX_set_not_resumable_session_callbackDTLS_server_methodSSL_CTX_set_quiet_shutdownSSL_certs_clearSSL_get_peer_signature_type_nidSSL_set_session_id_contextSSL_CTX_set_stateless_cookie_generate_cbSSL_CTX_check_private_keyBIO_new_sslSSL_CTX_set_session_id_contextSSL_set_post_handshake_authSSL_CTX_set_optionsSSL_get_errorBIO_f_sslSSL_get_peer_certificateSSL_read_early_dataSSL_CTX_set_next_proto_select_cbSSL_get_ciphersSSL_use_PrivateKeySSL_SESSION_freeSSL_get0_dane_authoritySSL_CTX_set_generate_session_idSSL_dane_tlsa_addSSL_get0_dane_tlsaSSL_set_optionsSSL_CTX_set_srp_strengthPEM_read_bio_SSL_SESSIONSSL_CTX_set_security_callbackSSL_connectSSL_CTX_set_client_CA_listSSL_CTX_sess_set_new_cbSSL_CTX_set_psk_use_session_callbackSSL_get_srp_usernameSSL_set_accept_stateSSL_CTX_set_max_early_dataSSL_waiting_for_asyncSSL_CTX_freeSSL_get0_peer_CA_listSSL_set_bioSSL_CTX_configSSL_CTX_set_stateless_cookie_verify_cbSSL_CTX_set_srp_usernameSSL_get_versionSSL_CTX_ctrlSSL_check_chainSSL_alert_type_string_longSSL_CONF_CTX_newSSL_do_handshakeSSL_CTX_set_srp_username_callbackSSL_CTX_use_PrivateKey_fileSSL_CTX_set_cipher_listSSL_callback_ctrlSSL_get_sigalgsSSL_get0_peer_sctsi2d_SSL_SESSIONSSL_CIPHER_get_nameSSL_SESSION_up_refSSL_verify_client_post_handshakeSSL_get_current_compressionSSL_alert_desc_string_longSSL_SESSION_set1_id_contextSSL_get_SSL_CTXSSL_is_dtlsSSL_CTX_set_srp_cb_argSSL_get_rbioSSL_CTX_set_alpn_protosSSL_CTX_set_ctlog_list_fileSSL_CTX_get_security_callbackSSL_state_string_longSSL_CIPHER_descriptionSSL_CTX_use_serverinfo_fileSSL_set_sessionSSL_SESSION_newSSL_get0_next_proto_negotiatedSSL_get_all_async_fdsSSL_has_matching_session_idSSL_get_peer_cert_chainSSL_CTX_set_default_verify_dirSSL_CTX_set_psk_server_callbackSSL_CTX_set_verifySSL_newSSL_CTX_set_cookie_generate_cbSSL_CTX_load_verify_locationsSSL_CONF_CTX_freeSSL_CTX_set_next_protos_advertised_cbSSL_is_serverSSL_CTX_use_certificateSSL_add_file_cert_subjects_to_stackSSL_COMP_get_nameSSL_SESSION_get_max_early_dataSSL_CTX_set_psk_client_callbackDTLS_client_methodSSL_get_current_cipherSSL_SESSION_get_idSSL_get_early_data_statusSSL_get_key_update_typeSSL_CTX_set0_CA_listSSL_get_srp_NSSL_CTX_get0_ctlog_storeSSL_freeSSL_SESSION_set_protocol_versionSSL_ctrlSSL_set_msg_callbackSSL_CTX_set_client_cert_engineSSL_renegotiateSSL_get1_supported_ciphersSSL_CIPHER_get_versionSSL_get_wbioSSL_get_optionsSSL_get_shared_ciphersSSL_CONF_CTX_finishSSL_use_certificateSSL_CIPHER_get_idX509_PURPOSE_get_countPKCS12_SAFEBAG_get0_attrPKCS8_pkey_get0_attrsBIO_ADDRINFO_familyX509_get0_pubkey_bitstrENGINE_load_public_keyBN_num_bitsASN1_GENERALIZEDTIME_printX509_POLICY_NODE_printNCONF_freeOSSL_STORE_SEARCH_by_aliasX509_STORE_CTX_get0_policy_treeEVP_PKEY_newENGINE_ctrlEVP_EncryptUpdateEVP_PKEY_verify_recover_initASN1_item_freeBIO_bindEVP_DigestInit_exX509_NAME_entry_countd2i_OCSP_RESPONSEPKCS12_SAFEBAG_get0_attrsSRP_create_verifierd2i_RSAPublicKey_bioASN1_UNIVERSALSTRING_to_stringOPENSSL_DIR_readASN1_TYPE_freeNETSCAPE_SPKI_b64_encodeOPENSSL_sk_deleted2i_X509_REQ_bioUI_destroy_methodERR_put_errorASN1_ITEM_lookupBIO_lookup_exRSA_printX509_ocspid_printX509_REQ_set_pubkeyCMS_ContentInfo_print_ctxOCSP_onereq_get0_idCMS_add1_signerOBJ_obj2nidGENERAL_NAME_freed2i_PrivateKey_bioERR_peek_last_errori2d_RSAPublicKey_bioBN_is_zeroEVP_DigestVerifyFinalX509_CRL_get0_lastUpdateSMIME_read_CMSPKCS12_unpack_authsafesEVP_DigestInitX509_verifyEVP_CIPHER_flagsBN_GENCB_setX509_STORE_CTX_initi2d_PUBKEY_bioBIO_write_exBN_is_oddOSSL_STORE_INFO_get_typeUI_processPKCS7_get0_signersOSSL_STORE_INFO_freeX509_LOOKUP_fileDES_ede3_cbc_encryptCMS_get1_ReceiptRequestOPENSSL_LH_errorPEM_write_bio_X509_AUXSEED_cbc_encryptOCSP_resp_get0_signatured2i_PKCS12_bioASYNC_cleanup_threadCRYPTO_strdupPEM_write_bio_CMS_streamEVP_PKEY_CTX_freeX509_set_subject_namea2i_GENERAL_NAMEOSSL_STORE_do_all_loadersCONF_loadCMS_RecipientInfo_typePKCS5_pbe2_set_scryptBN_printX509_keyid_set1BN_GENCB_freeEVP_PKEY_meth_get0_infoBN_add_wordEC_GROUP_set_point_conversion_formCMS_decrypt_set1_keyX509_CRL_printPKCS12_SAFEBAG_get1_certX509_VERIFY_PARAM_set_timeX509_digestd2i_EC_PUBKEY_bioPEM_write_bio_RSAPrivateKeyCMS_add0_recipient_keyCRYPTO_gcm128_aadAES_set_encrypt_keyEVP_des_ede3_wraps2i_ASN1_INTEGEREVP_PKEY_missing_parametersX509_to_X509_REQTXT_DB_get_by_indexHMAC_Init_exOCSP_check_validityX509_add1_trust_objectDSA_get0_keyCMS_compressOPENSSL_sk_sortDHparams_printOpenSSL_versionX509_REQ_verifyASN1_TYPE_newi2d_X509_NAMETS_REQ_set_nonceX509V3_EXT_REQ_add_nconfRC2_set_keyUI_method_get_closerOBJ_nid2objEVP_PKEY_asn1_get0PKCS7_signX509_VERIFY_PARAM_set_auth_levelOPENSSL_sk_numEC_GROUP_set_asn1_flagRSA_sizePKCS7_sign_add_signerOPENSSL_LH_freeBIO_readPBEPARAM_itASN1_item_d2ii2d_PKCS7_bioPKCS12_get0_macBF_cbc_encryptERR_get_errorX509_STORE_CTX_get0_parent_ctxi2d_X509_PUBKEYX509_CRL_verifyENGINE_get_idX509_subject_name_hashEVP_PKEY_get0_DSAX509_add1_reject_objectBF_optionsPEM_read_bio_DHparamsEVP_CIPHER_iv_lengthEVP_CIPHER_CTX_set_paddingX509_check_ip_ascX509_get0_pubkeyRAND_write_filePEM_read_bio_X509_REQX509_ALGOR_freeBIO_connectCMS_EncryptedData_decryptUI_add_verify_stringX509V3_set_nconfNETSCAPE_SPKI_freeEVP_PKEY_verify_initOCSP_cert_status_strASN1_INTEGER_to_BNX509V3_set_ctxOCSP_sendreq_newPEM_read_bio_PrivateKeyX509_CRL_get_issuerTS_MSG_IMPRINT_set_algoX509_LOOKUP_hash_dirCRYPTO_memdupEVP_PKEY_sign_initBIO_free_allX509_NAME_get_index_by_OBJX509_get_default_cert_dirBIO_printfCMS_RecipientInfo_kari_get0_ctxX509V3_parse_listCRYPTO_gcm128_releaseCRYPTO_gcm128_setivEVP_PKEY_asn1_find_strEVP_MD_do_all_sortedBIO_meth_freeTS_RESP_verify_tokend2i_TS_REQ_bioASN1_tag2strX509_STORE_set1_paramX509_get_ext_countPBEPARAM_freei2d_X509_bioBIO_number_readOSSL_STORE_SEARCH_by_nameOCSP_sendreq_nbioEVP_PKEY_get1_RSADSA_newX509_CRL_digestEVP_sha256TS_TST_INFO_freeOCSP_request_onereq_get0DH_freeOCSP_REQUEST_newX509_getm_notBeforeOPENSSL_DIR_endOCSP_response_get1_basici2d_PKCS7_bio_streamTS_VERIFY_CTX_add_flagsCRYPTO_mallocBIO_meth_set_ctrlOSSL_STORE_findEVP_PKEY_base_idBN_bn2decPKCS7_SIGNED_newX509_REQ_sign_ctxASN1_item_unpackBIO_sock_should_retryX509_get_pubkeyX509_OBJECT_get0_X509EVP_PKEY_CTX_new_idX509_PURPOSE_get0BIO_meth_set_createX509_time_adj_exOPENSSL_sk_shiftX509_http_nbioAES_optionsEVP_CIPHER_CTX_ctrlX509_STORE_CTX_set0_crlsX509_add_extOSSL_STORE_INFO_get0_NAMEi2a_ASN1_OBJECTX509_EXTENSION_freeNCONF_get_stringASN1_ENUMERATED_freeX509_CRL_set1_lastUpdateOSSL_STORE_INFO_get0_PARAMSOPENSSL_asc2uniOCSP_response_status_strEC_GROUP_get_point_conversion_formCMS_ReceiptRequest_create0PEM_read_bio_DSAparamsX509_ATTRIBUTE_get0_objectASN1_INTEGER_freeOSSL_STORE_eofEVP_PKEY_CTX_get_keygen_infoX509_CRL_add1_ext_i2dTXT_DB_create_indexOCSP_id_get0_infoBIO_dump_indentX509V3_add_valueX509_EXTENSION_get_objectX509_CRL_get0_signatured2i_PKCS8_PRIV_KEY_INFO_bioEVP_PKEY_print_paramsX509_REQ_add1_attr_by_txtX509_STORE_CTX_set_certX509_get_default_cert_areaEVP_PKEY_print_publicEC_curve_nist2nidHMAC_UpdateX509_get0_extensionsBIO_s_connectEVP_PKEY_new_raw_private_keyBIO_sock_infoX509_REQ_set_subject_nameOCSP_request_add1_nonceX509_STORE_set_flagsBIO_writeASN1_ENUMERATED_setBN_set_wordTS_RESP_CTX_add_failure_infoPKCS7_verifyBIO_nextGENERAL_NAME_get0_valueEC_KEY_printASN1_TYPE_getBIO_listenOCSP_basic_sign_ctxX509_NAME_ENTRY_get_datai2d_DSAPrivateKey_bioERR_print_errorsCMS_signHMAC_CTX_newTS_RESP_verify_responseOSSL_STORE_LOADER_get0_schemeCMS_get0_SignerInfosBN_bn2hexUI_method_set_readerX509_NAME_delete_entryBIO_sock_initCMS_RecipientInfo_get0_pkey_ctxASN1_TIME_set_stringOCSP_BASICRESP_newTS_VERIFY_CTX_newEVP_CIPHER_do_all_sortedX509_STORE_newPEM_read_bio_X509_CRLPKCS12_decrypt_skeyEVP_MD_typeOCSP_basic_add1_statusCMS_add1_recipient_certPKCS5_pbe2_set_ivi2d_RSAPrivateKey_bioBIO_meth_set_destroyOCSP_REQUEST_add_extRC4_set_keyUI_construct_promptX509_CRL_get0_nextUpdateERR_peek_errorASN1_INTEGER_newOSSL_STORE_loadASN1_TIME_compareDSAparams_dupX509_NAME_ENTRY_freed2i_PKCS8_bioEC_GROUP_get_orderX509_OBJECT_freeTS_CONF_set_tsa_nameBIO_set_tcp_ndelayBIO_popTS_REQ_set_policy_idX509_NAME_add_entryOPENSSL_uni2utf8BIO_meth_set_getsASN1_generate_nconfOSSL_STORE_expectDSA_generate_keyCRYPTO_zallocEC_KEY_generate_keyPEM_read_bio_EC_PUBKEYOBJ_txt2nidEVP_PKEY_paramgenX509_alias_get0X509_verify_cert_error_stringCMS_sign_receiptBIO_new_fileBIO_ADDRINFO_protocolX509_REVOKED_add1_ext_i2dCMS_uncompressOBJ_sn2nidOPENSSL_hexstr2bufERR_print_errors_cbOCSP_SINGLERESP_add1_ext_i2dBN_rshift1Camellia_set_keyPEM_read_bio_NETSCAPE_CERT_SEQUENCEX509_STORE_set_lookup_crlsBN_bin2bnEVP_MD_CTX_newTS_RESP_set_tst_infoEC_KEY_check_keyASN1_i2d_bioX509_NAME_print_ex_fpBIO_s_memPEM_read_bio_PUBKEYX509_VERIFY_PARAM_get0i2b_PublicKey_bioASYNC_WAIT_CTX_freeOSSL_STORE_INFO_get0_CRLEVP_MD_sizeBN_optionsRSA_public_encryptX509_STORE_add_crlX509_CRL_set_issuer_nameOSSL_STORE_INFO_get0_PKEYBIO_ADDR_service_stringX509_STORE_freeTS_STATUS_INFO_newX509_policy_tree_get0_user_policiesEVP_PKEY_paramgen_initBIO_socket_nbioERR_print_errors_fpBIO_meth_set_read_exSRP_VBASE_get1_by_userX509_NAME_freeEC_GROUP_freeTXT_DB_readNCONF_get_sectionEC_get_builtin_curvesOCSP_CERTID_freeX509_REVOKED_set_revocationDateTS_RESP_get_tst_infoEVP_md4EVP_md5UI_method_get_readerBIO_ADDRINFO_addressX509_NAME_add_entry_by_txtASN1_GENERALIZEDTIME_newBN_mod_expOCSP_copy_nonceEVP_DecryptFinal_exPKCS7_newEVP_PKEY_signi2d_X509_CRL_bioX509_REQ_print_exX509_set_serialNumberX509_sign_ctxd2i_OCSP_REQUESTBIO_f_cipherOSSL_STORE_supports_searchASN1_GENERALIZEDTIME_freeOCSP_REQ_CTX_add1_headerOCSP_response_createb2i_PrivateKey_bioPKCS12_SAFEBAG_get0_safesEVP_DigestSignd2i_ECPrivateKey_bioECDSA_signRSA_freei2b_PrivateKey_bioHMAC_CTX_freeX509_getm_notAfterBIO_f_base64X509_set_versionPKCS12_unpack_p7encdataX509_get_subject_nameERR_error_string_nENGINE_get_RANDSRP_VBASE_initEVP_ripemd160X509_policy_tree_get0_policiesEVP_PKEY_asn1_findEC_KEY_newSCT_validation_status_stringRSA_public_decryptCRYPTO_clear_freeEVP_aes_192_wrapX509_freePKCS12_SAFEBAG_get0_pkcs8X509_REQ_get0_pubkeyEVP_des_ede3_cbcOPENSSL_sk_new_nullEVP_PKEY_copy_parametersi2d_ECPrivateKey_bioDES_set_key_uncheckedEC_METHOD_get_field_typePEM_read_bio_ParametersPEM_write_bio_ECPrivateKeyd2i_DHxparamsPKCS7_to_TS_TST_INFOEVP_PKEY_keygenDIST_POINT_freeRSA_private_decryptDH_get0_pqgRSA_newENGINE_ctrl_cmd_stringX509_email_freeEVP_DigestSignFinalOPENSSL_strlcatENGINE_get_pkey_methsPEM_write_bio_X509OPENSSL_sk_pushBIO_freeEVP_CIPHER_CTX_key_lengthEVP_PKEY_CTX_ctrlX509_NAME_hash_oldX509_REVOKED_set_serialNumberOCSP_request_add0_idOCSP_REQ_CTX_set1_reqENGINE_load_private_keyBIO_get_callback_argX509_STORE_load_locationsPEM_write_bio_PUBKEYPKCS8_set0_pbeENGINE_get_RSARSA_verifyX509_NAME_ENTRY_get_objectTS_CONF_load_certsBIO_new_socketSEED_set_keyX509_reject_clearASN1_INTEGER_getOPENSSL_uni2ascPEM_read_bio_PKCS7BIO_f_mdEVP_PKEY_bitsPEM_read_bio_PKCS8BIO_test_flagsEVP_MD_CTX_mdPEM_write_bio_PrivateKey_traditionalENGINE_set_defaultPKCS12_SAFEBAG_get_bag_nidOSSL_STORE_LOADER_get0_engineTS_VERIFY_CTX_set_imprintEC_KEY_get0_groupX509_NAME_newX509_CRL_freeASN1_TIME_set_string_X509OBJ_nid2lnSHA512EC_GROUP_get_curve_nameDSAparams_printEC_KEY_set_conv_formENGINE_register_all_completePEM_write_bio_DHparamsSMIME_read_PKCS7EVP_sha1BIO_meth_set_putsX509_get_ext_by_OBJi2d_PKCS8_bioX509_CRL_set1_nextUpdatePEM_write_bio_X509_REQBIO_f_bufferRC2_cbc_encryptX509_INFO_freeCMS_ReceiptRequest_get0_valuesEVP_PKEY_get1_DSATS_RESP_CTX_freei2d_X509ASN1_UTCTIME_freeUI_create_methodX509_CRL_get_ext_d2iTS_CONF_set_certsEVP_DigestFinal_exUI_add_input_stringTS_CONF_set_ess_cert_id_chainBIO_meth_set_callback_ctrlCMS_decrypt_set1_pkeyX509_STORE_CTX_get1_chainCMS_finald2i_TS_RESP_bioBIO_s_fileNETSCAPE_SPKI_get_pubkeyX509_NAME_hashSMIME_write_CMSDH_get_lengthPKCS12_createEVP_DigestERR_add_error_dataBIO_ptr_ctrlUI_nullPBE2PARAM_freePBKDF2PARAM_itX509_SIG_freeEVP_PKEY_checkOSSL_STORE_SEARCH_by_key_fingerprintOBJ_ln2nidd2i_DSAparamsENGINE_get_digestsOBJ_nid2snTS_VERIFY_CTX_set_storeEVP_aes_256_wrapUI_freeTS_REQ_set_versionPKCS12_parsed2i_X509_bioSMIME_write_PKCS7BIO_ADDRINFO_socktypePEM_write_bio_RSA_PUBKEYd2i_RSAPrivateKeyBIO_ADDR_freeNCONF_newX509_newOPENSSL_LH_newCMS_get0_signersBN_GENCB_get_argd2i_DHparamsX509_REVOKED_newX509_check_hostPEM_read_bio_X509SHA1TS_CONF_set_signer_keyX509_get_default_cert_dir_envBIO_int_ctrlNCONF_load_bioEVP_DecryptInit_exBIO_new_mem_bufTS_CONF_set_clock_precision_digitsX509_alias_set1TS_STATUS_INFO_set_statusOBJ_txt2objEVP_PKEY_sizeX509_CRL_diffEVP_CIPHER_key_lengthTS_VERIFY_CTX_freeCMS_data_createPEM_write_bio_PKCS7PEM_write_bio_PKCS8ASN1_TIME_freeEVP_md_nullX509_VERIFY_PARAM_get0_namePEM_read_bio_PKCS8_PRIV_KEY_INFOBIO_set_dataSRP_user_pwd_freePKCS7_freeOCSP_resp_find_statusPBKDF2PARAM_freeX509_STORE_set_default_pathsASN1_TIME_printOPENSSL_strlcpyEVP_CipherRC4_optionsTS_CONF_set_digestsDSA_get0_pqgASN1_parse_dumpEC_KEY_precompute_multX509_print_exX509_VERIFY_PARAM_add0_policyASYNC_WAIT_CTX_get_all_fdsEC_POINT_point2bnENGINE_by_idWHIRLPOOLAES_cbc_encryptUI_method_set_writerOCSP_REQUEST_freeX509_VERIFY_PARAM_set1TS_REQ_newUI_get0_user_dataCMS_EncryptedData_encryptEC_GROUP_new_by_curve_nameX509_NAME_onelinei2d_TS_RESP_bioTS_CONF_set_signer_digestDSA_set0_keyX509_get0_notBeforei2d_X509_REQ_bioBIO_debug_callbackEVP_CIPHER_nidNCONF_get_number_eENGINE_get_pkey_asn1_meth_strSCRYPT_PARAMS_freeEVP_aes_128_wrapUI_get_string_typeEVP_DigestVerifyi2d_DHxparamsPEM_write_bio_PKCS8_PRIV_KEY_INFOi2d_ECPKParametersOSSL_STORE_INFO_type_stringBIO_new_fdX509V3_extensions_printBIO_new_fpCMS_digest_createX509_check_private_keyTS_CONF_set_orderingASYNC_init_threadUI_set_resultPEM_write_bio_X509_CRLOCSP_REQ_CTX_freeCAST_cbc_encryptASN1_UTCTIME_newX509_ALGOR_get0TXT_DB_writeX509_get0_signatureX509_VERIFY_PARAM_get_countEVP_PKEY_meth_get_countPKCS12_SAFEBAG_freeEVP_PKEY_verifyEVP_PKEY_CTX_set_cbEVP_DigestFinalOpenSSL_version_numOCSP_cert_id_newEVP_CIPHER_CTX_rand_keyEVP_CipherInit_exTS_CONF_set_serialCRYPTO_gcm128_newCMS_SignerInfo_get0_pkey_ctxX509_STORE_CTX_get_explicit_policyBUF_reverseTS_CONF_set_def_policyBIO_set_callbackTXT_DB_inserti2d_OCSP_RESPONSETS_CONF_set_policiesX509_CRL_add0_revokedUI_method_set_closerNETSCAPE_SPKI_verifyEVP_PKEY_print_privateBIO_f_nbio_testOBJ_create_objectsASN1_TIME_diffPEM_write_bio_DHxparamsEC_GROUP_checkEC_KEY_set_asn1_flagTS_MSG_IMPRINT_newCMS_set1_eContentTypeX509_REQ_get_extensionsNETSCAPE_SPKI_b64_decodeOBJ_NAME_do_all_sortedAES_encryptPKCS12_freeBIO_s_acceptEC_GROUP_get_cofactorPKCS12_SAFEBAG_get_nidEC_GROUP_get_curvei2d_TS_REQ_bioCMS_get1_certsTS_MSG_IMPRINT_set_msgASN1_INTEGER_setX509_subject_name_hash_oldOSSL_STORE_SEARCH_by_issuer_serialX509_REQ_set_versionOBJ_createTS_REQ_print_bioPEM_write_bio_PKCS7_streamX509_get_issuer_named2i_PUBKEY_bioASN1_get_objectBN_CTX_freei2d_DHparamsERR_reason_error_stringEVP_PKEY_set1_RSAENGINE_get_namePEM_write_bio_ParametersX509_add1_ext_i2dTXT_DB_freeX509_STORE_CTX_newOCSP_crl_reason_strPEM_read_bio_ECPrivateKeyEVP_read_pw_stringASN1_GENERALIZEDTIME_set_stringUI_method_get_writerX509V3_EXT_CRL_add_nconfBIO_set_flagsOSSL_STORE_INFO_get0_NAME_descriptionX509_STORE_CTX_get_num_untrustedPKCS7_add_certificateBIO_get_dataBIO_number_writtenX509_VERIFY_PARAM_set1_emailX509_get0_notAfterX509_STORE_CTX_get_current_certEVP_PKEY_CTX_ctrl_strGENERAL_NAME_printEVP_PKEY_idMD5i2d_DSAparamsTS_RESP_CTX_newEVP_PKEY_get_default_digest_nidTS_RESP_get_tokenCMS_add0_recipient_passwordEVP_PKEY_decrypt_initBN_newi2d_EC_PUBKEY_bioEVP_DecryptUpdateX509_set_pubkeyPKCS5_pbe_setEVP_PKEY_encryptPKCS12_unpack_p7dataTS_RESP_newBIO_ADDR_hostname_stringX509_get_serialNumberBIO_set_callback_argASN1_STRING_cmpSHA256BUF_MEM_growX509_printCRYPTO_mem_ctrlUI_OpenSSLX509_get1_ocspTS_MSG_IMPRINT_freei2a_ASN1_INTEGEROCSP_parse_urlPEM_write_bio_DSA_PUBKEYENGINE_freeX509_check_purposeBIO_newX509_VERIFY_PARAM_newDES_optionsd2i_ECPKParametersTS_TST_INFO_print_bioEC_KEY_set_groupOCSP_request_signX509_get_X509_PUBKEYRAND_pollX509_PURPOSE_get0_snameEC_GROUP_method_ofX509_set_issuer_nameOCSP_RESPONSE_printEVP_EncryptInit_exOPENSSL_LH_strhashTS_VERIFY_CTS_set_certsBN_bn2binPEM_write_bio_DSAparamsENGINE_get_DSAX509_STORE_set_verify_cbi2b_PVK_bioBN_dec2bnPKCS7_print_ctxOPENSSL_sk_valueEVP_PKEY_public_checkBIO_get_retry_reasonOCSP_REQUEST_printBIO_ADDRINFO_nextPEM_write_bioRSA_get0_keyNETSCAPE_CERT_SEQUENCE_newNETSCAPE_SPKI_newRAND_bytesBN_is_prime_exPEM_read_bio_RSAPublicKeyPEM_read_bio_ECPKParametersEVP_PKEY_decryptEVP_get_digestbynameBN_generate_prime_exX509_issuer_name_hash_oldX509_CRL_sortBN_randBUF_MEM_newPKCS7_finalTS_RESP_set_status_infoBN_GENCB_newOPENSSL_LH_insertTS_CONF_set_crypto_deviceCMS_dataRAND_load_fileBIO_set_initX509_ALGOR_newX509_LOOKUP_ctrlTS_RESP_freeEC_curve_nid2nistX509_REQ_newBIO_dumpDH_generate_parameters_exENGINE_get_firstb2i_PublicKey_bioPEM_write_bio_DSAPrivateKeyBIO_ADDR_rawportX509_cmp_timeX509_STORE_CTX_get_obj_by_subjectBIO_ctrlASN1_TIME_newOCSP_response_statusX509_CRL_sign_ctxX509_REQ_add1_attr_by_NIDX509_VERIFY_PARAM_set1_hostECPKParameters_printPEM_X509_INFO_read_bioX509_ATTRIBUTE_countEVP_get_cipherbynameBIO_meth_set_write_exEC_GROUP_set_seedEVP_PKEY_derive_set_peerX509_REQ_check_private_keyEVP_PKEY_encrypt_initECDSA_verifyASYNC_is_capableUI_add_user_dataSCT_printNETSCAPE_SPKI_signASN1_OBJECT_freeX509_gmtime_adjEVP_PKEY_verify_recoverCMS_encryptOCSP_id_issuer_cmpOCSP_REQ_CTX_httpEVP_PKEY_freeGENERAL_NAMES_freeOPENSSL_sk_pop_freeEVP_PKEY_asn1_get_countEVP_DigestUpdatePEM_read_bio_X509_AUXPKCS8_PRIV_KEY_INFO_freeEVP_aes_256_cbcd2i_ASN1_TYPEBIO_socketX509V3_conf_freeOCSP_RESPONSE_freeCMS_decrypt_set1_passwordBIO_parse_hostservTS_STATUS_INFO_freeOPENSSL_cleanseEVP_PKEY_get0_asn1GENERAL_NAMES_newCMS_verify_receiptX509_STORE_CTX_freeENGINE_get_nexta2i_ASN1_INTEGERX509_STORE_add_lookupEVP_CIPHER_CTX_newPEM_write_bio_EC_PUBKEYSRP_VBASE_newASYNC_start_jobX509_STORE_CTX_set0_trusted_stackEVP_PKEY_meth_get0ERR_clear_errorCMS_digest_verifyPKCS8_decryptRSA_private_encryptCRYPTO_reallocRSA_check_key_exTS_CONF_set_ess_cert_id_digestEVP_PKEY_add1_attr_by_NIDTS_REQ_freeBN_cmpASN1_ITEM_getX509_CRL_http_nbioSRP_check_known_gN_paramCMS_decryptTS_CONF_set_accuracyBIO_s_nullPKCS5_PBKDF2_HMACPEM_write_bio_ECPKParametersNETSCAPE_CERT_SEQUENCE_freeBIO_new_connectOCSP_basic_verifyX509_PURPOSE_get_idX509_VERIFY_PARAM_set_flagsX509_delete_extTS_RESP_create_responseBUF_MEM_freeCamellia_cbc_encryptPKCS12_SAFEBAG_get0_p8infOPENSSL_sk_freePEM_read_bioX509_STORE_CTX_get_errorUI_ctrlASN1_item_printEVP_PKEY_CTX_newPEM_write_bio_PrivateKeyENGINE_get_DHCRYPTO_memcmpCAST_set_keyDH_newEVP_PKEY_asn1_get0_infoOPENSSL_LH_retrieveDSA_dup_DHd2i_X509_CRL_bioX509_check_emailHMAC_FinalCMS_ContentInfo_freeDES_cryptBIO_getsOCSP_RESPONSE_newDH_bitsOCSP_BASICRESP_freePKCS12_set_macX509_VERIFY_PARAM_set_purposeCMS_ReceiptRequest_freeX509_VERIFY_PARAM_lookupASN1_UTCTIME_set_stringPEM_write_bio_X509_REQ_NEWX509_CRL_set_versionEVP_PKEY_get0_RSAASN1_STRING_seti2d_DSA_PUBKEY_bioEVP_MD_CTX_freeUI_new_methodEVP_PKEY_param_checkEVP_PBE_findBIO_ADDRINFO_freeUI_method_set_openerPBE2PARAM_itEVP_PKEY_deriveTS_RESP_CTX_set_signer_digestEVP_CIPHER_CTX_freeX509V3_EXT_add_nconfEVP_EncryptFinal_exX509_NAME_add_entry_by_NIDCONF_modules_loadX509_trust_clearOSSL_STORE_INFO_get0_CERTPKCS7_encryptTS_RESP_CTX_set_status_infoBIO_snprintfPKCS12_SAFEBAG_get0_typei2d_RSA_PUBKEY_bioASN1_d2i_bioPKCS12_verify_macOSSL_STORE_openOCSP_check_nonceSCRYPT_PARAMS_iti2d_OCSP_REQUESTX509_VERIFY_PARAM_set_depthX509_REQ_freeEVP_PKCS82PKEYEVP_DigestSignInitEC_KEY_set_enc_flagsX509_VERIFY_PARAM_set1_ip_ascPEM_read_bio_CMSTS_REQ_set_msg_imprintBF_set_keyOPENSSL_hexchar2intENGINE_get_ciphersBIO_closesocketASN1_STRING_lengthi2d_PKCS8_PRIV_KEY_INFO_bioEVP_PKEY_set1_DSAOPENSSL_LH_doallX509_NAME_dupBN_CTX_newTS_REQ_set_cert_reqRSA_pkey_ctx_ctrlCMS_add1_ReceiptRequestX509_SIG_get0ASN1_STRING_set_default_mask_ascNETSCAPE_SPKI_printEVP_PKEY_get1_EC_KEYX509_VERIFY_PARAM_freeX509_STORE_CTX_set_flagsX509_CRL_print_exPEM_write_bio_RSAPublicKeyPKCS12_mac_presentASN1_PRINTABLE_typeASN1_ENUMERATED_newi2d_PrivateKey_bioX509_NAME_print_exTS_REQ_to_TS_VERIFY_CTXDSA_printOCSP_cert_to_idEC_KEY_freeX509_get1_emailPKCS7_decrypti2d_ASN1_TYPEUI_get_input_flagsSRP_get_default_gNDSA_generate_parameters_exOCSP_request_onereq_countBIO_vprintfOSSL_STORE_SEARCH_freed2i_CMS_bioEVP_BytesToKeyDH_sizePEM_write_bio_NETSCAPE_CERT_SEQUENCETS_CONF_get_tsa_sectioni2d_PKCS12_bioX509_get_extCRYPTO_set_mem_debugi2d_CMS_bio_streamX509_get_signature_nidEVP_sha512NETSCAPE_SPKI_set_pubkeyDES_ncbc_encryptEC_GROUP_get0_generatorEVP_PKEY_derive_initDSA_freeX509_PURPOSE_get0_nameRSA_new_methodX509_NAME_get_index_by_NIDEVP_PKEY_keygen_initENGINE_initCRYPTO_freeTS_VERIFY_CTX_set_dataBN_freeBIO_ADDR_newEVP_PKEY_CTX_set_app_dataUI_method_get_openerTS_RESP_print_bioBIO_meth_newTS_CONF_set_signer_certEVP_PKEY2PKCS8BIO_ADDR_rawaddressEC_KEY_new_by_curve_nameOCSP_REQ_CTX_newBIO_callback_ctrld2i_PKCS7_bioRC4DSA_set0_pqgX509_STORE_CTX_get_error_depthBIO_accept_exRSA_signb2i_PVK_bioX509_verify_certBIO_read_exBN_to_ASN1_INTEGERX509_REQ_get_subject_nameEVP_PKEY_CTX_get_app_dataOSSL_STORE_closeASN1_STRING_get0_dataOPENSSL_dieX509_NAME_get_entryX509_CRL_newBIO_new_dgramRSA_generate_multi_prime_keyX509_get_ext_d2iX509_signBIO_pushOSSL_STORE_errorCMS_verifyX509_issuer_name_hashAES_ige_encryptX509_PURPOSE_get_by_snameBN_hex2bnEVP_DigestVerifyInitASYNC_WAIT_CTX_newBIO_putsENGINE_ctrl_cmdENGINE_finishX509_ATTRIBUTE_get0_typeDH_check__errno_locationfflushstrcpy__printf_chkstrncmpstrrchrpipeperror__isoc99_sscanf__fdelt_chksignalstrncpyfork__stack_chk_fail__lxstatunlinkputcharselectstdin_exitkillstrtodstrtokstrtolsymlinkfgetsstrlenopenlogmemsetstrstr__syslog_chk__fprintf_chkstdoutfputcfputsmemcpyfclose__strtol_internal__vsnprintf_chkstrtoulsetsockoptstrcasecmpsetpgid__ctype_b_locgetenvstderralarm__memset_chkreadlinkstrncasecmp__fxstatfilenofwriterename__memcpy_chkwaitpidstrchrfdopenqsortsleeptimes__ctype_toupper_loc__strcpy_chk__cxa_finalize__sprintf_chk__xstataccesssetbufstrcmpstrerror__libc_start_mainstpcpy__strtoul_internalsysconflibssl.so.1.1libcrypto.so.1.1libpthread.so.0libc.so.6GLIBC_2.2.5GLIBC_2.15GLIBC_2.14GLIBC_2.4GLIBC_2.3GLIBC_2.7GLIBC_2.3.4OPENSSL_1_1_1OPENSSL_1_1_0       b ui ,b"b 8b Cbii Nbii Xbii bbti lbui ,ba0mxbmbbmxbmb 7 7  2 @ M ` k    (( :0 8@ P X 2h *p T  7  *  +  8+  h+  +  + ( 0 @ +H X (,` }p P,x O<     _  x,   |  , ? 8 D ,   H 0 -8 [H 0-P M` Th ix P- m p- t z    -    -  .( 8  .@ P @.X h h.p  .  .   & .  8/ , p/ A  / 4( =0 Y@ /H aX  ` lp 0x u X0  0  0   1 ' H1 0 8 ee H x3P E` 2h ]x 2  2  2  2 $ 2 2 2 3 3 > 3( 38 3@ 3P 4    UJ  H oJ 7 J [ J  _  x, | L( e 8 J@ JP JX Jh Jp  K /K !K  ;K LK 0L SK hL 9 L 9 L 9( D0 9@ 0DH PX \K` yp Lx G  qK K M  K k_  8M   ( NN0 7@ hNH  H X  7` [p 7x N N  N    [ 7 [  H  [  [0 78 H [P y` [h x [  \ \ \ \   \ ]  :  \  ] +\  P]( 4\8 =\@ 'P PH    NN  H   7 7 hN [ 7 y #^ 8  1^( 8 ?^@ I^P P^X h 0p   1 ' PH    H   7  NN [ 7  70 hN8 H [P y` ah ax b  \ \ \ \ a b   b   \ ] b  b( )b8 (c@ P :X 'h H1    i 7 J  H  k [ k y( i0 8 @ iH X k` lp (jx l Xj  l 7  j )b (c b b I^ 4l  0  0  18 'H H1   n n 2 n  H   7 [ 7   n    o( V8 o@ SkP oX h !op ee  ;o Jo 0q  Po no uo  P r#  Pq l o Z ( q0 o@ oH 2\X o` op ox x o ) o o p } q @ r  p @r 8\ p  0 :8 H 0P `  1h 'x H1   TZ   { { | "{ | [ 8| ( 00 @  1H \X ]` p wx ' H1 7{ %{   | |  H   7 [ 7@ P X [h ˀp   H   ۀ ^       ]8   G  * D( 0 M@ H [X 8` # p hx R  g Ȉ {       H ʁ   ց0 8 LKH P y` (h x    * P 0 x V  7 > Z Ȋ e  ( 98 9@ 9P 0X 9h Dp 9 0D r P    x    ȋ 9 ‚ e ( ނ0 ?@ H ^ X ` p #x Z   A  F   O X U  ث  ] ، d0 8 hH @P e ` ph x p O< E : : : : ; ; '; F 2;! 9;! Q; ! a;(! x;8! ;@! ;P! ;X! ;h! 8Fp! ;! ;! ;! `F! ;! ;! <! (<! F<! F! V<! F" b<" F" n<(" G0" z<@" <H" <X" <`" <p" @Gx" <" <" <" hG" =" =" .=" G" 9=" D=" ^=# G# l=# ; # z=0# H8# =H# (H# # #  # # # # ܐ# # # # $ $ & $ 8($ R8$ h@$ P$ X$ h$ p$ ב$ З$ eR $ $ $ $  H $ >$ ]8% @% % W % t0% c8% zH% P% `% h% x% % ˒% x% } % % % %  % Ù% % %  o& &  & 0(& 8&  1`& p& x&  & '& A& G& `& g& f8& & & & ' ' ' 0 ' P0' X8' H H' ǝP' ݝ`' h' x' ' ' ' ' ء' ' ' "' ' =' )' ;( E( ] ( c(( v8( (@( zP( X( h( `p( ( ( ( 0( (  1( :( ( ( Þ( 7 ( ؞) ) )  () 0)  H @) H) [X) ˀ`) p) x) \) ]) :) ) 9) ) 9) <) 9) D) 9* 0D* * : * '0* H1`* p* x* * NN*  H *  7* 7* hN* [* 7* * գ* y+ 0+ + X + 0+ 8+ 'H+ H1+ + + + + 7+ +  H +  7+ [+ 7+ ץ, ݥ, " , (, 8, P@, P, 0X, h,  1p, , , , ., I, x, @, O, , , \, ]- k- - '(- H10- w@- ~H- X- `- p- x- Ӧ- ܦ- - - - - 7. . .  . \0. ]8.  H H. [P. [`. 7h.  \x. Ш. \. \.  . . y. . . 1. . :. k/ 0/ ' / H1(/ 8/ F@/ \P/ e/ / /  H /  7/ [/ 7/ y/ / / / '0 H10  0 @0 P0 X0  H h0 oJp0 [0 k0  \0 0 0 (0 0  0 $0 ,0  0 P1 P1 <1 S(1 x01 ce @1 H1 pX1 Ю`1 8p1 x1 a1 h1 }1 1 1 1 1  1 :1 1 ի2 H2 2  2 ݫ02 82  _ H2 pP2 Dy`2 h2 x2 02 2  12 '2 H12 .Q2 2  2 J2 N2 <3 3  3 03 83 H3 P3 7`3 h3  H x3  73 [3 73  \3 \3 \3 3 \3 ]3 3 3 4 ,4 E 4 V(4 84 [@4 yP4 [X4 h4 pp4 4 4 4 :4  \4  ]4 +\4 P]4 4\4 =\4 '4 H1 5 05 85  H H5  7P5 [`5 7h5 :x5 [5  _ 5 p5  \5 5 5 `5 " 5 5 5 5 6 6  6 (6  86 @6 PP6 <X6 h6 p6 $6 ,6 6 6 ce 6 6 p6 .6 86 F6 6 7 7 07 (7  107 '@7 H1`7 p7 7 7 7 7 7 7 7 7 8 8  8 08 `8 p8 x8 ^ 8  8 8  8 w 8 8 8 8 #8 8 )9 9 ) 9 . 9 ˒09 <89 PH9 HP9 ?`9 ph9  x9 9 K9 M9 | 9 9  _ 9 9  9 09 99 J9 9: g: 9 : D(: 98: 0D@: P: XX: h: p: : : : : : : : 8: : : : ; ; h; (; )0; C@; IH; O8X; `; p; ^x; t; ; q; |; ; ; ; 8; ; 0; <  1< <  < 0< 8< H< pP< `< h< x< < < < "< 0< 7 < h< < G< W< < d= = l = (= 8= 8@= P= `X= h= p= = = = = 2 =  = = H= = = = > > >  (> 0> @> 0H> #X> X`> !p> x> .> > A > > :> (> E> p> J> > P? ? [? i ? 0? 8? H? @P? `? xh? x? ? ? ? ? ? ?  ? !? +? @? E? c@ @ f @ k(@ 8@ @@ P@ X@ h@  p@ Ճ @ @ @ P@ @ @ @ @ @ @ @ @A s<A xA ((A 0A !@A HA  XA H`A jpA HxA 3bA xA :A A 3A A 0A A =A @A JB pB YB  B o0B 8B O<HB EPB :`B :hB :xB :B ;B ;B ';B FB 2;B 9;B Q;B a;B x;B ;B ;C ;C ; C 8F(C ;8C ;@C ;PC `FXC ;hC ;pC <C (<C F<C FC V<C FC b<C FC n<C GC z<C <D <D <D <(D @G0D <@D <HD <XD hG`D =pD =xD .=D GD 9=D D=D ^=D GD l=D ;D z=D HD =E (HE |E  E 0E 8E HE  PE `E @hE xE xE E E E E E E E E $E E F F  F (F +8F /@F FPF LXF \hF dpF vF {F b F F 3F F F (F F F F G G PG (G 0G @G +HG HXG `G 'pG H1xG UG G D:G HG gG G lG vG G G / H H H @H PH XH hH @ pH ~H  H )H  H ) H .H ˒H <H G H  H  H N I PI HI  (I  0I ?@I P HI KXI M`I e pI  xI :I  I  I I | I  I  _ I  I  I 0I m J 8 J J s J  0J p 8J  HJ  PJ  `J  hJ  xJ  J J H J O8J J J  J J J J hJ CK  K 9 K g(K 98K J@K 9PK DXK 9hK 0DpK  K p K K  K  K  K  K  K  K  K #K   L  L H L  (L  0L  @L  HL .XL `L " pL  xL ' L 0 L L 0L L  1L L L L L M GM WM  M 2 0M ` 8M 1 HM  PM `M  hM xM  M = M F M \ M 8 M dM M lM M M p M N N  N (N  8N @N tPN  XN qhN f pN A N N ~ N  N  N  N  N  N  N  N N P O O  O (O `0O ce @O  HO JXO  `O PpO  xO [O iO O O O @O O xO O O P P P  P 0P  8P !HP +PP @`P EhP cxP P fP kP P P P P P  P Ճ P P Q PQ  Q (Q 8Q @Q PQ XQ hQ @pQ s<Q xQ (Q Q !Q Q  Q HQ jQ HQ 3bQ xR :R R 3(R 0R 0@R HR =XR @`R JpR pxR YR R oR R O<R ER :R :R :R :R ;S ;S ';S F S 2;0S 9;8S Q;HS a;PS x;`S ;hS ;xS ;S ;S 8FS ;S ;S ;S `FS ;S ;S <S (<S F<T FT V< T F(T b<8T F@T n<PT GXT z<hT <pT <T <T <T @GT <T <T <T hGT =T =T .=T GU 9=U D=U ^=(U G0U l=@U ;HU z=XU H`U =pU (HxU |U U U U U  U U @U U xU V V vV { V b 0V  8V  HV   PV 3`V hV xV (V % V . V H V @ V V T V V d V V v V $W  W  W  (W  8W  @W +PW  XW  hW h pW  W  W FW  W \W   W  W & W HW  W W pX EX  X '(X H10X @X HX @ XX H `X ; pX  xX / X O X j X  X y X  X v X H Y Y Y w (Y H 0Y :@Y HY 3XY `Y ?pY  xY KY MY | Y  Y 9Y JY  Y gY 9Y gY 9Z DZ 9Z 0D Z q0Z ! 8Z P HZ ; PZ @`Z EhZ PxZ  Z L;Z  Z  Z @ Z Z Z [ i[ 7 [  ([  H 8[ oJ@[ [P[ kX[ yh[ s p[ ?[  [ [  [  [  [ % [ % \ % 0\ & @\ & P\ & `\  & p\ )& \ 2& \ ;& \ D& \ M& \ V& \ _& \ h& \ q& ] z& ] & ] & 0] & @] & P] & `] & p] & ] & ] & ]  6 ] 3 ] / ] ( ]  ]  ]  ] ! ] ' ^ ' ^ ' ^ !' 0^ *' @^ 3' P^ <' `^ E' p^ N' ^ W' ^ `' ^ i' ^ r' ^ {' ^ ' ^ ' ^ ' _ ' _ ' _ ' 0_ ' @_ ' P_ ' `_ ! p_ ( _ ( _ ( _ ( _ ) _  ) _ ! _ ) ` ) ` 0` @` QP` } `` ~ p` ^~ ` $) ` .) ` ` 5) ` ` #` ` $a <a T a ?) 0a K) @a W) Pa `a pa a la a c) a a $a a l) a r) b  b 0b 8b  H Hb  7Pb [`b 7hb | xb p8 b  _ b 8 b b b 7 b 7 b b 7 b b 8 b 6_ c xc P c 8 (c )8 8c 8 @c 'Pc H1c c c 2c .@ c Tc c 7 c = c % c L@ c d g@ d @ d = (d @ 8d > @d nPd @ Xd  hd (> pd @ d X> d d d \d ]d d 0d d  1d 'd H1 e 0e 8e r# He Q Pe # `e Q he Vxe Q e  e R e " e R e Pe R e Ske 6R e e QR e ee f mR @f d Xf d pf d f d f d f f d f d g d g e 0g e Hg &`g e xg )e g >e g Re g `e g ge g oe h ue h * 8h 7Ph {e hh e h e h e h Ve h e i e i e 0i e Hi e `i e xi e i e i e i e i f i  f j f j %f 8j ,f Pj :f hj Ff j Pf j Zf k k k l l  H l (l [8l (@l ] Pl Xl hl pl l  l % l l 7l ;l Pl Yl rl Xl yl m u m m (m 0m @m Hm u Xm `m pm 8xm m m u m @Am u m hAm u n 6n n  n 0n A8n 7Hn APn  H `n  7hn [xn 7n pn !7n 8n 17n  n K7n X7n An e7n l7n Po 7o 7(o 7@o 7Po 7Xo 7po 7o 7o 7o 8o 8o 8p &8p <80p y@p (BHp J8`p T8pp PBxp ]8p Bp f8p Bp n8p Bp u8p ~8p 8p Cp 8q (Cq :q 8 q 80q HC8q 8Pq 8hq 9xq 8q  9q 8q  9q 9q )9q hCq q Cq 19q G9q a9r u9(r 98r 9@r Pr 9Xr 9hr 9pr 9r Cr 9r Dr 9r 0Dr 9r xDr r Dr 9s 9s  :0s :Hs Xs `s ps ':xs s 2:s s ?:s Vs G:s _:s Ds e:s n:s }t  Et :t XE t  _ 0t E8t EyHt EPt :ht :t t :t t 0t t  1t O<t Et :t :t :u :u ; u ;(u ';8u F@u 2;Pu 9;Xu Q;hu a;pu x;u ;u ;u ;u ;u 8Fu ;u ;u ;u `Fu ;u ;v <v (<v F<(v F0v V<@v FHv b<Xv F`v n<pv Gxv z<v <v <v <v <v @Gv <v <v <v hGv =w =w .=w G w 9=0w D=8w ^=Hw GPw l=`w ;hw z=xw Hw =w (Hw =w =w =w =w =w =w >w  >w 'x PH@x u Px PRXx u hx pRpx x x nx lPx >Jx Rx x Rx [x Rx x y  y yPy P(y S0y P@y @SHy =} Xy P`y  _ py hSxy oy Py 8y Py Vy Py y Py Py Sy Qz  Qz S z S z i0z P-8z 'QHz SPz `z Khz xz 0z z  1z 'z PHz .Qz  Tz u z dUz u { 6{  { ({  H 8{  7@{ P{ UX{ 7h{ Up{ [{ 7{ { U{ y{ Y{ { Y{ { 0{ {  1| 8 | U| z (| Z0| } @| PZH| UX| Z`| 'p| PH| u | t| u | t| | | ee | t} "t} t} !t(}  u0}  t@} PuH} >JX} pu`}  p} ux} %t} u} (t} v} ,t} 8v} u } hv~ u ~ v~ u (~ v0~ @~ `~ u p~ Pwx~ u ~ 6~ ~ ~ [~ pw~ \~ ]~ ~ 0~   1  w  '0 H1` p x [ 7 7 x   ] y y  +y Dy z Ly Uy y0 ry8 H PzP '` H1h u x xz u  u Ȁ Ѐ   u  x u ( 0 @ H oX ` p x ; ) @ ȱ O E u  u  6  ( [8 7@ P 0X h  1p l  o $ ' H1 u 0 u  6  ( |88 @ &P `X h p  - ee ;o Ѓ ؃  NN 7 hN  H   7 [0 78 | H UP  _ ` hh 6_ x x q  T   Ȅ ؄ ˸ \ ]  0   1( 8 @ DyP X ih P-p t   H    Pȅ Ѕ z .  K 2 ;o ( 8+0 K@ MH ]X d` yp x  p u    І ̹؆  +      0 8 H P ` Ph x   K ' H1    u @A u  hA u 6( 8 @ pP !7X 8h 17p  K7 P 7 T [ T8Ȉ PBЈ 8 HC ]8 B f8 B u8( ~80 n8@ BH 8X (C` p 9x V G: _: H  H  7 Љ A؉ : XE  _ E [ 7 70 A8 9H xDP ` ':h x 2:  ?: y (B 9 0Ȋ 9؊ 9 9 D 9 0D e7 l7( s 8 x @ 8P CX 9h 8p  9 8  9 9 )9 hC ȋ 0Ћ   1   }  E ( :0 O<@ EH :X :` :p :x ; ; '; F 2; 9; Q;Ќ a;، x; ; ; ; ; 8F ;0 ;8 ;H `FP ;` ;h <x (< F< F V< F b< Fȍ n<؍ G z< < < < < @G( <8 <@ <P hGX =h =p .= G 9= D= ^= G l=Ȏ ;Ў z= H = (H ' H1@ u P h3 X u h 6p   S$ 3 8 3 U* ȏ 3 Џ Z* 4 ]* P4 #  `*  {* ( p4 0 @ 0H X  1` 'p H1x * 4 7{ 4  5 " А 85 ؐ * h5 u 0 D 8 H P [` kh x  y E  A H A ȑ N ؑ A B B  *B  e @E ( ^ 8 pE @ /KP E X =^ h N Й pP ؙ K M O< E : : :0 :8 ;H ;P ';` Fh 2;x 9; Q; a; x; ; ; ;Ț ;ؚ 8F ; ; ; `F ; ;( <8 (<@ F<P FX V<h Fp b< F n< G z< < <ț <Л < @G < < < hG =( =0 .=@ GH 9=X D=` ^=p Gx l= ; z= H = (H 'М H1   ( T 0  H @ oJH 7X T ` [p kx  _ p  T ^ [\ \ Н u\ ؝ \ \ G \   \ e 0 J8 ;H \ P ` \ h x  ] : U 2] ]  pȞ 6_ ؞ 8] /K 8U =^  N]   g] (  8 ~] @ ] P `U X ] h ] p ] ] ] ]  ^ U ^ ȟ U П ^ U $^ -^  V  C^ ( XV 0 u @ L^ H X c^ ` {^ p V x ^ V Z V ^ W ^ Р PW ؠ ^ ^   y W  0 W 8 8 H ^ P ,` W h x 0   1  W K Mȡ ^ ء X ^ 8X ^  XX  ^ xX ( ^ 8 ^ @  _ P _ X ih P-p 0_ X =_ X I_ X LKȢ 8Y Т  K S_ pY d_  Y  '( H10 t_ @ Y u   3b0 ` Abp ?b Lb 3b  Ab ?b LbH P 7X k h 1 p fx @ 2 М     m < @        @x ( 0 8 z H # P X  h Up x  x `      %b '  ' 0? |   K ~ ( 0 L8 `~ H P RX ` h 'p Yx     n  # . ^  3 n @  8 P $ ( ?0 p8 `& H P @X `* h Fp x + "  - L  / V  @0 #        ( ^0 0#8  H ^ P 6X  h *p \x  3 e c  5 l ` `8 u  @H ~ P@ Y    I Z ( 0  N8  H P PX @ h p px  b >  c       P )     /  e ( 0 @48  H P h p    }    ~  6~  ( ^~ 0 H P h ’p  ͒  ֒  ߒ     ( 0 H P h  p       $ '  0 '   < '  ( H0 '8  H TP 'X  h `p 'x  l '  y '   '   '    '  ( 0 '8  H P 'X  h ɓp 'x  ֓ '   '   '   '     '  ( 0 '8  H &P 'X  h 3p 'x  @ '  M '  Z '  g '   u '  ( 0 '8  H P 'X  h p 'x   '  ǔ '  ؔ '  l '     '  ( 0 '8  H P 'X  h lp 'x   '   '   '   '    '  (  0 '8  H P 'X  h p 'x  # '  + '  7 '  D '   L '  ( X0 '8  H eP 'X  h mp 'x  y '   '   '   '    '  ( 0 '8  H P 'X  h p 'x  • '  ʕ '  Օ '   '    '  ( 0 '8  H P 'X  h p 'x   '   '   '  $ '   - '  ( 50 '8  H =P 'X  h Ep 'x  M '  O  u O  u O  u O  v 8 `7 & p7 ' 7 ' 7 ' 7 ( 7  ( 7 ( 7 !( 7 +( 7 5( 8 ?( 8 I( 8 S( 08 ]( @8 g( P8 q( `8 {( p8 ( 8 ( 8 ( 8 ( 8 ( 8 ( 8 ( 8 x) 8 |) 8 8 9 ) 9 } 9 9  9 ) (9 ) 09 ) 89 ) @9 ) H9 ) P9 ) X9 ) `9 ) h9 ) p9 ) x9 ) 9 * 9  * 9 S$ 9 ~ 9 ^~ 9 $) 9 1* 9 =* 9 I* 9 r) 9 9 07 9 UG 9 J 9 8J 9 J : cG : J : J : K : PK (: K 0: K 8: cG @: K H: (L P: XL X: L : n : ?: : ': n : m : y: n ; m @; { P; { `; { p; { ; { ; { ; { ; { ; | ; 2| ; L| ; e| < ~| < | < | 0< | @< | P< | `< | <  } < } < -} < :} < G} < Y} < k} < } = } = 8\0= } @= } P= } `= } p= } = } = } = O= Mu = Ku > } > } > } 0> } @> ~ P> &~ `> =~ p> N~ > e~ > y~ > ~ > & > ' > ~ > ~ > ~ ? ~ ? ~ ? ~ @?   P?  `? , p? C ? S ? b ? q ? ~ ?  ?  ?  ?  @ D @  @  0@  @@  P@  `@  p@ , @ 8 @ F @ ` @ W @ n @ x @ 3@  A  A  @A ŀ PA Ԁ `A  pA  A  A  A ) A ? A M A a A v A  B  B  B  0B ́ @B  PB  `B  pB  B  B ' B : B N B ^ B q C  C  C  0C  @C ւ PC  `C  pC  C ( C 4 C C C Q C ` C t C  C  D  D Ń D ԃ 0D  @D  PD  `D * pD  D = D Y D o D  D  D  D  E  E  E  @E  PE  `E Ƅ pE ӄ E  E  E  E  E  ) 8 I   :  7 J  9   C  ; ( 0 F8  @ GH >P KX A` mh Dp x  L  1 5 T g = H E @ M j 8 k <`k ?k BE GE M      ȥ Х إ          ( 0 8 @ H P X ` h p x     ! " # $ % &Ȧ 'Ц (ئ * + , - . / 0 1 2 3( 40 58 6@ 7H 9P :X ;` <h =p >x ? @ A B C D E F G Hȧ IЧ Jا K L M N O P Q R S T( U0 V8 W@ XH YP ZX [` \h ]p ^x _ ` a b c d e f g hȨ iШ jب k l m n o p q r s t( u0 v8 w@ xH yP zX {` |h }p ~x          ȩ Щ ة          ( 0 8 @ H P X ` h p x          Ȫ Ъ ت          ( 0 8 @ H P X ` h p x          ȫ Ы ث          ( 0 8 @ H P X ` h p x          Ȭ Ь ج          ( 0 8 @ H P X ` h p x              ȭ  Э ح          ( 0 8 @ H P X  ` !h "p #x $ % & ' ( ) * + , -Ȯ .Ю /خ 0 1 2 3 4 5 6 7 8 9( :0 ;8 <@ =H >P ?X @` Ah Bp Cx D E F G H I J K L Mȯ NЯ Oد P Q R S T U V W X Y( Z0 [8 \@ ]H ^P _X `` ah bp cx d e f g h i j k l mȰ nа oذ p q r s t u v w x y( z0 {8 |@ }H ~P X ` h p x          ȱ б ر          ( 0 8 @ H P X ` h p x          Ȳ в ز          ( 0 8 @ H P X ` h p x          ȳ г س          ( 0 8 @ H P X ` h p x          ȴ д ش          ( 0 8 @ H P X ` h p x               ȵ е ص          ( 0 8 !@ "H #P $X %` &h 'p (x ) * + , - . / 0 1 2ȶ 3ж 4ض 5 6 7 8 9 : ; < = >( ?0 @8 A@ BH CP DX E` Fh Gp Hx I J K L M N O P Q Rȷ Sз Tط U V W X Y Z [ \ ] ^( _0 `8 a@ bH cP dX e` fh gp hx i j k l m n o p q rȸ sи tظ u v w x y z { | } ~( 0 8 @ H P X ` h p x          ȹ й ع          ( 0 8 @ H P X ` h p x          Ⱥ к غ          ( 0 8 @ H P X ` h p x          Ȼ л ػ          ( 0 8 @ H P X ` h p x          ȼ м ؼ          ( 0 8 @ H P X ` h p x               Ƚ н ؽ          ( 0  8 !@ "H #P $X %` &h 'p (x ) * + , - . / 0 1 2Ⱦ 3о 4ؾ 5 6 7 8 9 : ; < = >( ?0 @8 A@ BH CP DX E` Fh Gp Hx I J K L M N O P Q Rȿ Sп Tؿ U V W X Y Z [ \ ] ^( _0 `8 a@ bH cP dX e` fh gp hx i j k l n o p q r s t u v w x y z { | } ~ ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X  `  h  p  x                       ! "( #0 $8 %@ &H 'P (X )` *h +p ,x - . / 0 2 3 4 6 7 8 9 : ; < = > ? @ A B C D( E0 F8 G@ HH IP JX K` Lh Mp Nx O P Q R S U V W X Y Z [ \ ] ^ _ ` a b c d e( f0 h8 i@ jH kP lX m` nh op px q r s t u v w x y z { | } ~        ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8 @ H P X ` h p x                      ( 0 8  @  H  P  X  ` h p x                 ! " # $ % & '( (0 )8 *@ +H ,P -X .` /h 0p 1x 2 3 4 5 6HHHtH5b%d@%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%h P%h @% h 0%h %h %h%h%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %Zh!%Rh"%Jh#%Bh$%:h%%2h&%*h'p%"h(`%h)P%h*@% h+0%h, %h-%h.%h/%h0%h1%h2%h3%h4%h5%h6%h7p%h8`%h9P%h:@%h;0%h< %zh=%rh>%jh?%bh@%ZhA%RhB%JhC%BhD%:hE%2hF%*hGp%"hH`%hIP%hJ@% hK0%hL %hM%hN%hO%hP%hQ%hR%hS%hT%hU%hV%hWp%hX`%hYP%hZ@%h[0%h\ %zh]%rh^%jh_%bh`%Zha%Rhb%Jhc%Bhd%:he%2hf%*hgp%"hh`%hiP%hj@% hk0%hl %hm%hn%ho%hp%hq%hr%hs%ht%hu%hv%hwp%hx`%hyP%hz@%h{0%h| %zh}%rh~%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڿh%ҿh%ʿh%¿h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ھh%Ҿh%ʾh%¾h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڽh%ҽh%ʽh%½h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%h P%h @% h 0%h  %h %h%h%h%ڼh%Ҽh%ʼh%¼h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %Zh!%Rh"%Jh#%Bh$%:h%%2h&%*h'p%"h(`%h)P%h*@% h+0%h, %h-%h.%h/%h0%ڻh1%һh2%ʻh3%»h4%h5%h6%h7p%h8`%h9P%h:@%h;0%h< %zh=%rh>%jh?%bh@%ZhA%RhB%JhC%BhD%:hE%2hF%*hGp%"hH`%hIP%hJ@% hK0%hL %hM%hN%hO%hP%ںhQ%ҺhR%ʺhS%ºhT%hU%hV%hWp%hX`%hYP%hZ@%h[0%h\ %zh]%rh^%jh_%bh`%Zha%Rhb%Jhc%Bhd%:he%2hf%*hgp%"hh`%hiP%hj@% hk0%hl %hm%hn%ho%hp%ڹhq%ҹhr%ʹhs%¹ht%hu%hv%hwp%hx`%hyP%hz@%h{0%h| %zh}%rh~%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڸh%Ҹh%ʸh%¸h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڷh%ҷh%ʷh%·h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڶh%Ҷh%ʶh%¶h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڵh%ҵh%ʵh%µh%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%h P%h @% h 0%h  %h %h%h%h%ڴh%Ҵh%ʴh%´h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %Zh!%Rh"%Jh#%Bh$%:h%%2h&%*h'p%"h(`%h)P%h*@% h+0%h, %h-%h.%h/%h0%ڳh1%ҳh2%ʳh3%³h4%h5%h6%h7p%h8`%h9P%h:@%h;0%h< %zh=%rh>%jh?%bh@%ZhA%RhB%JhC%BhD%:hE%2hF%*hGp%"hH`%hIP%hJ@% hK0%hL %hM%hN%hO%hP%ڲhQ%ҲhR%ʲhS%²hT%hU%hV%hWp%hX`%hYP%hZ@%h[0%h\ %zh]%rh^%jh_%bh`%Zha%Rhb%Jhc%Bhd%:he%2hf%*hgp%"hh`%hiP%hj@% hk0%hl %hm%hn%ho%hp%ڱhq%ұhr%ʱhs%±ht%hu%hv%hwp%hx`%hyP%hz@%h{0%h| %zh}%rh~%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڰh%Ұh%ʰh%°h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%گh%үh%ʯh%¯h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڮh%Үh%ʮh%®h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڭh%ҭh%ʭh%­h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%h P%h @% h 0%h  %h %h%h%h%ڬh%Ҭh%ʬh%¬h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %Zh!%Rh"%Jh#%Bh$%:h%%2h&%*h'p%"h(`%h)P%h*@% h+0%h, %h-%h.%h/%h0%ګh1%ҫh2%ʫh3%«h4%h5%h6%h7p%h8`%h9P%h:@%h;0%h< %zh=%rh>%jh?%bh@%ZhA%RhB%JhC%BhD%:hE%2hF%*hGp%"hH`%hIP%hJ@% hK0%hL %hM%hN%hO%hP%ڪhQ%ҪhR%ʪhS%ªhT%hU%hV%hWp%hX`%hYP%hZ@%h[0%h\ %zh]%rh^%jh_%bh`%Zha%Rhb%Jhc%Bhd%:he%2hf%*hgp%"hh`%hiP%hj@% hk0%hl %hm%hn%ho%hp%کhq%ҩhr%ʩhs%©ht%hu%hv%hwp%hx`%hyP%hz@%h{0%h| %zh}%rh~%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڨh%Ҩh%ʨh%¨h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڧh%ҧh%ʧh%§h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڦh%Ҧh%ʦh%¦h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zh%Rh%Jh%Bh%:h%2h%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڥh%ҥh%ʥh%¥h%h%h%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zhп%Rh%Jh鰿%Bh頿%:h鐿%2h逿%*hp%"h`%h P%h @% h 0%h  %h %h%h%h%ڤhо%Ҥh%ʤh鰾%¤h頾%h鐾%h逾%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %Zh!н%Rh"%Jh#鰽%Bh$頽%:h%鐽%2h&逽%*h'p%"h(`%h)P%h*@% h+0%h, %h-%h.%h/%h0%ڣh1м%ңh2%ʣh3鰼%£h4頼%h5鐼%h6逼%h7p%h8`%h9P%h:@%h;0%h< %zh=%rh>%jh?%bh@%ZhAл%RhB%JhC鰻%BhD頻%:hE鐻%2hF逻%*hGp%"hH`%hIP%hJ@% hK0%hL %hM%hN%hO%hP%ڢhQк%ҢhR%ʢhS鰺%¢hT頺%hU鐺%hV逺%hWp%hX`%hYP%hZ@%h[0%h\ %zh]%rh^%jh_%bh`%Zhaй%Rhb%Jhc鰹%Bhd頹%:he鐹%2hf逹%*hgp%"hh`%hiP%hj@% hk0%hl %hm%hn%ho%hp%ڡhqи%ҡhr%ʡhs鰸%¡ht頸%hu鐸%hv逸%hwp%hx`%hyP%hz@%h{0%h| %zh}%rh~%jh%bh%Zhз%Rh%Jh鰷%Bh頷%:h鐷%2h逷%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڠhж%Ҡh%ʠh鰶% h頶%h鐶%h逶%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zhе%Rh%Jh鰵%Bh頵%:h鐵%2h逵%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڟhд%ҟh%ʟh鰴%Ÿh頴%h鐴%h逴%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zhг%Rh%Jh鰳%Bh頳%:h鐳%2h逳%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڞhв%Ҟh%ʞh鰲%žh頲%h鐲%h進%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%Zhб%Rh%Jh鰱%Bh頱%:h鐱%2h週%*hp%"h`%hP%h@% h0%h %h%h%h%h%ڝhа%ҝh%ʝh鰰%h頰%h鐰%h逰%hp%h`%hP%h@%h0%h %zh%rh%jh%bh%ZhЯ%Rh%Jh鰯%Bh頯%:h鐯%2h逯%*hp%"h`%h P%h @% h 0%h  %h %h%h%h%ڜhЮ%Ҝh%ʜh鰮%œh頮%h鐮%h逮%hp%h`%hP%h@%h0%h %zh%rh%jh%bh %jf%zf%f%f%f%f%f%f%œf%œf%œf%ʜf%ڜf% f% f% f% fAWAVAUATIUH=]SHHdH%(H$81$HD$KHHǺiH5\>HÿH\Hn`HUaH=\H:Ht8ote1H=\IHH=1H5\TH$8dH+%(DHH[]A\A]A^A_ÀxnuxuYHIH5[Hx 9LHHHopenssl./HH@ cnf 1@vH=9H5b舭H=!H5b[1H=H5H[LH|$H5*[*H=H=&6 `H=ٶ6 eIHPI<$}Ht$LHD$HHtI$LP,H\$0IAIH=bZAH5TH=HH4DLHA?LN~#HcA|\uH=ZHcA)IEHL8HT$t$Lbt7H=11Ҿ `H=i11Ҿ K13uIT$LaŅHH='H5`1tH= HD$H=H5AH1F\H=H5Y.f1I^HHPTL:H H=ޗDH=HH9tHƗHt H=H5H)HH?HHHtHHtfD=Yu/UH=Ht H=Zh1]{f.AWH3AVAUATUSHdH%(H$1D$THD$XHD$`HD$h={IeLH5HHHD$ E1E1E1D$8HbD$0D$D$D$4D$<HD$(HD$@諃 wHcHf+HT$TH{uDLH5oH= 1E1E11E1E1LALHH=u pLxH|$`0H5!2H|$h1H5 LH\H$dH+%(aHĘD[]A\A]A^A_D$4裂蓋D$@Mt.rLP[IH HLT$TrL#[IHMLwZIHE11E1D$<C苅11HOD$0&fDkI[IKIH=1E1E11輊E1E1LE1LH FfDHþHD$ HH= 1H5UH1L%qϦH=h H5LHP0H=O L1H衦H9HuD$TD$[HD$(KHD$;HH#11HD$fDD$11HD$8IHPT$NHL$XHT$hLHt$`LD$xeHD$X1IEHD$xIEIEH<HD$XHL$x1HT$pH\$\$@Ld$(ILt$@ILl$HIHT$eHt$LI1H)Ll$p~LI裭MLr IGMLhLc H9H輣11H~ HL9iH藣H=@ H5vH1菤1E1HvHtL|$L |$(1ہ|$THD$x1@HHD$xHD$xH L%H"Ht$x IuLIEHD$X`E1D$0HcHD$xH9t$8H)HD$x…t9FMt*HLHt$XT$HL$ T$HL$9 D$4JHL$XH$HHL$ H$1H$sH;HL$ E11HH=HD$ LL$Ht$ L:H=H5(1H=11E1H5H=zuLLMH\$Ld$(Lt$@HD$XHL$xLl$HH|$(HzVIHH|$H|$LLHHD$ IHH1vHc؅HL0HIEH$LH$;L胪H\$x1H\$Ld$(Lt$@Ll$HH5HH=k1ġH=]X~HFHHLHOLIH0H5H=1lH=aH\$Ld$(H5=Lt$@Ll$HDD$L$A:H=LfD8>SRH=kzPH5"1袕L{HcHL#Kxd@L1wIL9t*AH=J^wH51IIL9uH=H5,}1/f.H51뙃0t7H{3Ce{iuC$CH5<DH߉$ C$Ff.H=H51kfDH51RDH51:D蛤HD$ HD$E<H|$8H:IM2DŽ$HDŽ$HD$@A~$H|$\9$$H|$~HxHD$PDžAIDLHÅxHz H=IHD$LhLMtH|$ 1ɺLWJAf.H5D1;DLHIMDŽ$1E1H$L$ LH=E MNHD$H=H5HP1KfDHD$ H=LhL[ H=LtH=LkHD$H=uH5HP1ÑDŽ$1E1H$L$L%@I?^LIL9u`H5HLH|$ LH$8dH+%(= $HH[]A\A]A^A_H=H51 H=1E1H$L$HD$ DŽ$*HD$H=aH5*HP1诐D%E$}IHHbH|$XHHHD$EHt$ L{$HT$`LHt$x*YH|$`t4L11H$H{Hc$H$Ht$ LVH\$(H蔸LHy6H|$@tvD$H$E1E1E HLLHH5RH@ $ H袒HT$@LHH= [ $Ht$(L  LHHt 3 $d$ueH|$ AHHuHDf褯H0DHƅyLH[HL11HH$HHH|$XtH5WH= yH$H$H>H$?HD$HL$HD$HLHxHH]H=OH$H51虍H=2H51脍HEHHE8RHUH~H=H51HUH9H=H51HU H H=yH51ˌHU(H1H=WH511H$蟌DŽ$H|$8LH81H$L$DŽ$H=1E1E1H5rH$&L$DŽ$kH=H51iH\$$H$H$MH|$ 1ɃL H=NH51蠋H|$ HHD$ HH=LH51^HD$HLHx蓐HHH=H$H51H=H51gH5&oH$H5 6H$HHH=[H51H$L$蝊DŽ$Hý$\H= H5E1^LH=HH$H=1H5&7#$ujH=H5H1H$H=11ɾ wHH߾Ƅ$H$H=1A%H=H5p1AH=LH5m1AЀff.AWAVAUATUSHLH(Ht$H5ҲHT$ HL$HH,H3IHI,LH$Ht HH$Ht/腾HIHHH軯AŅMttE1H5 L=ʣ K4LD!AŅII uH=eL1E1H5E1A@H$H]E1AHD$HtD HD$AHtL8E1H H5טLH(D[]A\A]A^A_DAAtX E1wH<$=IH\H4$H5AŅA AEAGDH<$H<$1ڪIH#HD$HL8AE1E1Af.H= 1E1E1H5U~H=H5ܲ1E18~H=H1E1H5ϲ~H$H=H5!1}H=H51E1}jH=nH5в1}PLAE1:H=>H511} H$H= H5d1r}ff.fATIUHSH0HL$HT$dH%(HD$(1Ht$ H|$ D$ HD$HD$HD$ FtZHHt$ Hܼt@1ۃ|$ HT$HE11ɾH۝AąutH 1E1亄 H5ɮ1H|$H|$HTH|$ HD$(dH+%(H0D[]A\f.HT$HuvHE1|$ AA{fDHH_Hct$ H躨Aą;E11HھHAąf.HE11ɾΜHAąm6fDAW1HE1AVAUE1ATL%U1S1HXL5dH%(H$H1f$=HDŽ$HDŽ$HDŽ$HDŽ$5Ƅ$?DŽ$tDŽ$xHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$LD$XH$DŽ$HD$0HDŽ$DŽ$D$DDŽ$DŽ$D$(DŽ$DŽ$DŽ$DŽ$D$DŽ$HD$hHD$`HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$HHDŽ$HD$PHD$8HD$pHD$xHD$HD$HD$ fDSDž,|-wIcLfD0~;uD$@H=HD$0fD w|$@V|$@H$!$ffDD$(\$[H=@LH5H$1xL,IHL95$tH<D$@4H`LHɭ1,HH9H5<脑IH!L萮LLD$@H5LHmHLïIH HD$@ H|$0t9HH9L膯HH H= HDŽ$LHHDŽ$p6HH] 0$pHH̬HLIH H$pH<IH$ L H=oHD$011E1D$@E1HD$fDHD$02fDŽ$ kTH$xHIfDH=H$H51;vD$@H=HD$0HD$1E11E1E1E1D$H11H5cH|$D$@tH$H55H$LLHH|$^LfH|$0$HL}H=U}H|$ VH$HdH+%(D$HX[]A\A]A^A_f S 1H̝H$fDŽ$pDŽ$`QD$CDŽ$0H|$RoRH|$H貫 NDKRH$fD3RH$fDRD$(HD$8fD$XQ1H! HD$ H= 1E1E1LW1E1E1ϩ1ȩ1H5ba1ӷD$HD$0DsQ 1H4H$KQ 1H H$DŽ$ QHD$pDŽ$PHPH$~fDPHD$HifPD$DHD$8IfPD$DHD$8)fkPD$(HD$P fKPD$(H$fD+PIPH$fDPH$fDOIOHD$xOHD$qO 1H|HH$MDOHD$h9f{OHD$`!DŽ$DŽ$KOH;OI+OH$H=¿HD$01E11HD$H=E1E1{HaH5LǨHH~H=dH 8H1H5%pH=AHD$0HD$0H=&1D$@E11E1HD$E1YM?L$D$@MbLD$ LL1ҋ$xL A)L$IMtLLHMET$XH|$P$$A9H$*D$HD$0HDŽ$EH)H5LpH{tHDŽ$HHL[IHH=H11H ؟H51E19iH=HD$0HD$HlHLIHH=H11H @H5YE1E1hD$@H=gHD$0HD$HD$0H=@3DŽ$ A-sHH-H$(sHs1H$AVH5@H= hHD$H=1E1rrH=LH5gH=u1E1E1HD$H=XH5agH=C11E1H51E1gD$@H=HD$0HD$[H=LH54OgnH=LH5A4gSH HL HD$hHqH$H$HHLUHDŽ$H=fH5O1fHD$11E1H=ASH51fD$GVH5V1ifD$'H$H=H5AfD$H=H5V!fH=AVD1H5ݩH$1E1eH=HD$H=wH5ɜ1L$H$LeLnEH51eD$TRH5r1veD$4H$AVH5%H$H=AV1H5 ˙$H$6L$ $ĤIH1H螃1DŽ$HXH$H$(L$ @IEHx89}]IEHxecIH8VuEHHIt$HmPLHHYgLH$H$(L$ 7g$$&H$Ht5H6HIH$ H|$H D$( $$t(H$$$D$H$|L}AƃpH|$1H|$H57uE$|kHD$H|$H$8|$(B$$H|$xdHxHL觚HHDŽ$D$($L5M H|$`Ht$`1_H|$h,Ht$h1?H$$$H$HH1vHt$xL5IH*tzHD$HH|$P$t$H$Ht$P1H$H$ H$(H$H$0H$H$8H$H$@;{H$HxH$H55&HH$H֧H$HH$}H$XHD$xH$P1H$H$HHv9H_HxHt-Ht$ƒ,@<:AH@tބHEHMH$`H$h0H$hH$`H5; uH}*wHD$xH>HrHLHD$HH=11E1$|ΩH$AQAAj$H$`!zAZA[yH$H$H$sH|$xɇ1袜H=1E1GH=H5H$6_H=ʭH|$xH$H$XH=1H5^H|$x]uHH|$xHHD$P"LD$PSH=^H5C1LD$P^LD$PH$L薊LD$PLiH$MLAPj$ P$$P$@$PAT$$$Pj$$$$P$P$$$AUL$H$H$6$H$PHĠ;~H$辒H|$x1|$P@H$2$tD$($H$H$H$H$H$HH$H$H$ H$H$(HD$xH$H=H51\H|$x譎HHH|$x觌}H=XLH571\H|$x11&rIHtH$VMLj$P$$P$$AT$AR$L$PD$`P$h$$$P$P$$$AUL$H$H$2$8L$PHĠL4|H|$xb$ItNH=BH51[H$uH$H|$訒D$PH|$8$tD$(T$xJH$QL$`Q$R$$LQP$$QAT$L$XQ$$$$Q$Q$x$$AUAVL$L$(H$H$(HĠ'1H$H\$xH$HHD$( 9$D$t$LH$H4RL$`Q$R$$LQP$$PAT$D$XP$$$$P$P$x$$AUAVL$L$(H$H$8&HĠfH=H5q1D$PgYH$es"H$H|${H=̽H5dH\$xYH$趩H=H51XH$rxH$H|$L$(L$PH=QH51E1XH=9H=-H51XH$}rH$H|$蓏t D$PH5}H=׼10XH\$xH\$xH=1E1H|$H\$xL$(訞|$urL$(T$PH5Z1H=qWH=e11Ҿ GHH$5 Ƅ$5mIH$5QIFH=ǤDH5}1@LH=H5M?hH=H5?Ptt@ATAHUHH+t uAuH.HD]A\AVAUIATUSXIHtx1Z@LV>E1ɹ1I11耈IHtH3HHt@LHpvt1HLavtUL…9|[L]A\A]A^fE11H5+LE1HLI[L]A\A]A^DE1AWIAVLE1AUL-ATUSHMA9}~DL1s=IGfDL[=H=LHOH=HOH=H5:OL߄9|LAτA9|H[]A\A]A^A_ff.AUIHATUHS1H薄!+HH|$|H|$|H|$@?H54QH|$X@H5QLD$(AH5qLQH|$` H|$ aH|$87|H|$0-|Ht*H{|HH[HJPHuH|$xy1ŇH$踇H|$p讇H|$wLDH$DH$H$|H|$P|H$X|H|$HlH$xYH5|P@fDA"EDA5DAv%DA?DA A@ÀA@AA@AA ASDH$nfDH$VfDsH$H H.A@A @AAHAH$D1H!H$@H$D HvfH=YE1E1E1HD$xHD$pHDŽ$HD$HD$ HDŽ$HD$HHD$P2AA@AA@ADA-DA+DADA}DA)mDA]DA'MDA5=D[A0H$ DŽ$A$D3H$fDCjH$fDmH$fDCdH$fDH|$8 H|$8HiuDH|$0 H|$0HiMDA HD$ H D$(aH|$AH|$xB8HD$HHt9tVH5$8(IJ$8HIGAIGHX HD$HL|$HLxHHD$HHxiH$PHN^H|$ tKH|$(H|$%Ht$(H|$hH|$EHt$ H|$hHD$((HD$ fDH$hHfDH|$(tVH|$/L|$(H|$LhHL$ LHHEH|$HD$ Ht$ H|$gHD$ HD$([{H$(FfDcH$.fDABH|$h 5H߂HHHH|$h[gfD H$ fD H$fD HD$PH|$`" 1H[HD$`Ho H=;H5*H1/Dk H$6fDH|$XG H$HgHD$XHH$H$@H|$@5 H$H?gHD$@H?H$H$@ H$fDDŽ$xDŽ$0h H$VfDs H$>fD[ HD$x)$L== % H$L HsDŽ$DŽ$DŽ$H H$H|$ H|$( H|$ Ht$(H|$dH|$$ HD$ HL$(H|$HHEHdH|$PH$x11HD$(HD$  D D$HAAĀDŽ$HDŽ$DAH$` H|$@t H|$XA I>Ht H|$h H Dl$Ll$hfLIcI>HH"7HHuHD$PE1HD$xHD$pHDŽ$HD$HD$ E1AHDŽ$HD$H HD$E1H|$1H|$(:H|$sH=pH51+HDHD$HHD$xE1E1AHD$pHDŽ$HD$HD$ HDŽ$HD$HHD$PCHD$HfDCHD$HcnCHD$HNHD$ H D$H$H D$@HD$ HD$H=XH51*HD$0HD$@HD$H=#H5t;HD$0D$HeH|$xHt#1H$pL{H|$A" ˆ$?A?A")ASA?Ƅ$?HD$pHDŽ$HD$$DH$rHD$PHD\$HE!$D==\H|$P19IMH$t7H$X(oH$H5{BHD$HH$XHJH$t9L;H$HHD$ LD$ s H5LlH$H$LHTH5{HEAH$Hf$L==H$18H$H$O $HH$wTHD$HHHD$xA$A0ˆ$AA4 A A AXA?$8 ASHD$ ADH$E1 D$Ll$p$H$Hl$D$L|$D$ELmA9DL&H|$DIHD$(%LHzHIHL$$P1HH$xL yHHH$HHH[HD9#uD$HLLH$h3IHHHD$7MHsHKLD$bH|$ tHt$ L]ELAE1vH1fD$HAĀHD$hHZHlPU>HD$0Hf;>HD$8HL|$HL11*BH$5E1H|$HwH$H H|$ HƄ$?HD$pL$H$x1L x$PH|$ HD$H&HD$xE1HD$ E1AHDŽ$HD$HHD$P|HD$H=8H5Z1$HD$HHD$1111>jH$)!H$H D$@H D$hHD$H=H51$HD$0HD$@HD$hHD$8HD$2fH=iH5J5CH=6H5{H1H=H53r1kH$H=H5rAEE1HD$xHD$ HDŽ$HD$HH|$PDCHD$ IM$?uhA'PA+A) A-A$$$`$4 E1E1lA]HD$@Ht(L$HL$XHLH$$ HD$HtH$HL#$ H$HtHHL/G LD$HE11H$XLKRE1H=iH5|LD$(ALD$(|H$hH|$PDC[HD$ ImH=H5yH1e%H58pLHD$P6HD$xE1E1AHD$pHDŽ$HD$HD$ HDŽ$HD$HH|$PDBHD$ IHD$ DH$`Ht$P1@D$(VIHq DD$E1 @D$D$ H$DH|$hc9'H|$h<HHtkIMmMtVA9muT$ LM/IHtPH]_IuHLahH$tt7oT$(L.IHuLd$ H$E1A~LE111H$H[itH=H5mH1lH=iE1HD$xHD$pHD$[H=H5?n1AE1HD$xHD$ HDŽ$HD$HH=H5n1H|$  HD$pƄ$?H=FH5mH1Ht$HDL0gE1_A>H=H5v+HD$ E1A$H= =i z HT$PH|$HDLp&kE1AHL$xH$pELH$FH=[~H5m1E1LD$HHT$xELH$XH$p37H=~1H5TmcH|$(t(L"H|$(HI6L^$LE1 "IH$HD$(vH$L$H$H$TH$";H=k}H5m*H$hH$$0$H=+}HH=}H5l)H$H=|H5l)H$H=|H5l)H$aH$eL^A9yDLAHt$(H3H=|DH5l$1$H=R|H5k)LD$HHt$@ELH$XH$$E1^ LHD$xE1HD$pHDŽ$HD$^HD$PHD$@D$D$H$HtEAQH1LjjjL$LD$xH$U6HD$@H HHD$XH$tVH$\H5i.IHVI11jLHD$PHHD$0_AXLD$@AHD$@HD$ Dd$(HT$HH$XDL5E1EE1111LtJH=zH5i1AE1Hl$H$E1ALl$pH$A@t$HuAHL$PA@11H$pE!IHKHD$`Ht HL9HH|$8HSIH.H|$0HtHD$ LD$ HH$1 HD$ HgH=yH5sA9&E1HD$ LHD$ HH1H$pHT$EHt$pH[cHD$ HLE"Dd$(Lt$ H$HT$@EH$`H|$P$ HD$ I6HT$HH$XDL+\QH5hH=x1E1H=xbE1HD$xHDŽ$HD$H$H=UxH5fAE1HD$xHD$ HDŽ$QL$(Ht$P1L:HD$@HD$ E1AHD$ E1H$AHD$ E1AH5L-WHD$ _HD$pHl$H$E1ALl$pH$HD$@AtHD$@AHD$ WH=wH5pA#E16Ll$pD$Hl$H$D$H$D$AS)AHt$P1DLBH=vH5lpAA#E1H=rvH5spA #E11$TH=CvtLu5H5)f"HH="vH5kp"H=v `DH5e1WH5e"H=u1H56e,E1$D= uA HT$(H=uH5 eAE1HDŽ$H|$H11L?E1HT$PH|$HDLYH5oH$HtH$H|$HH1H5%edH$ HtH$H|$HH1H5e9H$(HtH$H|$HH1H5dDAvtHT$PH|$HL#2H$XH|$HL 2@AWE1AVE1AUATIUS1HdH%(H$1:LH9HD$pE1H-zD$dD$hD$lD$8D$\ID$XD$TD$PD$0D$4D$D$D$ D$HD$HHD$@HD$ HD$HD$(f.twHcDHDH=LI[LL$LLM HL[T$4cHD$xAHD$ Ll$Dl$PDd$4ED|$8LDE9:D9d$E9D9d$D9d$tJD9d$0AD9D9d$ u蝓HIb6H=#oLH5LrH9H=o1H5_rR H LH\HKH=nHH=nH51 _H=nH5q1 H#TH=nHH=nH5Զ1 H5H.H=[nH5qH1 11ҾXHH=-nH5aqI1t MH= nL7L(H=mH5D1? cH5HH=mH5qH1 JLl$Dd$4T$hH|$(w IHiD$TKE:|$hHLyHH=JmH5pE1L$\T$XHt$HH|$@JIHt!LHr7IHCH$HL4$11LLaDH4LH!WIHJHHLIPH|$pE1yLH=lH5moH1JD$xH\$@H\$8LI@U H=kH5;o9и:+E1HD$x9ɋ\$@L?H=kH5n1H=lkH5n_HHt$x1t1H|$xE1$蘏HLH*CH=kH5o1E1]H=jH5mE1x:zLE1VH=jH5mE1mH5Z15H=jH5o1`H=tjH5pLl$E1@H=TjH5]o1E1#9:fAWHw2AVE1AUATL%qU1S1H8dH%(HD$(1D$ D$$H$IwIcLHT$ HuDH=iLH5@41AE1E11E1HILJH:LGUL/UHD$(dH+%(H8D[]A\A]A^A_ÐHbHH;"zf. fD+H$fI HT$$H@H=0E1E1E1c1E1 f[HHHE1E11E1AfAątE1E1GIH0HHGI^ HS(IFHT$GHT$H;HBG{HH]HCMtL;:IH;HCD$HDHxI9D$ut$HH5UHHD$HD$HH|$111HHu< HH0IHtLHD$9LD$ILRHHuH|$HHFD$DT$ rL3IHD$ =t\H=|f1E1E1H5mA1H=YfTP1AA1E1A111LIME1E11A1LNIIӋT$$H<$wgHHtD$$tX=t@D$E1AH=eH5"m1AH=eO5LH$D$LHsDD$HT$H=QeH5vl1F1gEH=0e1E11H5lAwH=e OHT$H=dH5;l1LH|$2F1 EfATIH5>USHoHHs&Ht[]A\fH5mHQ&HuUHDPtHQHtHSI<$H5l1AD$AD$tI<$[H5X1]A\fDI<$H5{1vAD$ZAWAVAUIATIUHSHHH$DD$ L $L$HD$H$L$HD$dH%(HD$81HD$( f11Ҿ LiDu11ҾLTDu` HL5yH=EcLH5k1H=-c(MH\$8dH+%(HH[]A\A]A^A_MtS1ҾxHL$0LC$H|$0L3-]H5PkL1DH<$`HL$01ҾxLyCH<$P)= H|$0HT$(H L$ ^Ht$H{LHD$HtHH5kL1pLH5kL1\D$(AL= 8DtH5?L1+IBT-1LLD9l$(H5L11MnHt$(QL$HejL$JDH=aaH5j1H=LaGK HL=HcHT$(H=aKH5iL1V1T$(HL/1?HH5iHD$(6HIHHD$HHLH5iL1H=`H5RiH=w`rJLHHxHLLL1D18 @HHH9uHLH$茇H$E1I1fD@7HHH9t/3HHI|MD @ uH\AAnMDAAtcT$(1L=֑~#TLL1H9\$(LH5ghL1:H5WhLD1H59hL L识It//ff.@AWAVE1AUATAUHSHlHH>dH%(H$1HDŽ$HDŽ$DŽ$!H5g ILL$HD$ x HD1HHD$h?D$HD$(ID$pD$0D$PD$4HD$@HD$`HD$XHD$8HD$HD$HD$DtG|wHcH@#w͉Nw.quDA`D$tA4HHD$xA~H|$@uD\$(E9DT$HEHED$HD$HHPI;H@IMHDL$PE11H$L蹩s|$0DD$0Et D$0H|$`w[IHH|$XH5gH|$8HtU|$p$L LD$ H11芳H$HH,H -?WHt$XHHT$H1H$HDŽ$bf1H|$tELd$PHl$(H:H$HIGH=9|Ld$PH$H$'H$A"HD$8HdHt$HHH¿W4H$HH,1H$xLHDŽ$HDŽ$H=TH5D&1E1AH$H1٨H$HH=BTH5]H=/T*>AH$HH$1ҾxLHHD$8HDŽ$4HtH|$hHT$HHt$hH$-H=SH5:]H=S=eH=SH5\<H=uSp=H$yqD$(KHD$8LH=/S1Ld$PHH5U\yH=S =H$'H=RH5T\1FH=R<H Q1ҾjL3HHLPjjD$HPUL$DD$`L$dHT$xHt$PH0AH=sRHH5[1Ld$(H=VRQH5HHD$W2*LT$HI;T$$H=>1LT$H5`MSH==H5U1>HE1E1LT$ 11LARt$4LT$(AYAZLT$DD$E<$|$,3T$8EPLL$A L$HH.HL$L$|$,L$H1HE1jE11LY^L$HL$E1 L$@D$[#HT$(HѪ9fH=<LH5X1c۵I˵HT$,Hy裵IH=E1E1E1E1E1 k1HnHfAuDD$c1Ƀ|$(11LIE1ML$H5KH=;1AH=;%L$iH8Ht$$zB\$$1E1E1A2ED$H=LLL$%L$L$H5UYHL$@HT$8LLT$HD$0Ht$0HD$8HD$@bH|$0H|$0$$H5QÍzI bH=:H5#SH$1L$Ht$0H=v:HQiL$Ht$8H=X:HQiL$Ht$@H=::HQiH=':H5R1qH=:H5R1\H=9ىH5 S1CH=9ىH5AS1*H=9ىH5xS1H=9H5S1L$H5PLdLT$LLLT$LT$H=Y9ٺ'1H5QLLL$L$H5HH=1LI:H=8H$H57Q1E1A?L$L$H5OH=81AL$H=8L$"H5QHLZL$}H=z8u"H- L$F_f.DAWHWE1AVE1AUE1ATU1SHSHxdH%(HD$h1D$DHD$PHD$XHD$`D$H詤D$$D$ ID$D$0$D$,D$(D$8HD$HD$HD$D$4@+wHcHf۵Ht$PHuf.H=97L1E1H5E1E1zLbLzLBHZkH|$XH5RH|$`H5QHD$hdH+%(Hx[]A\A]A^A_fD$$C3Å9DD$EH|$D AHT$XL ȉL$E1E1E1H=21E1E1H5VG1H=2H=2E1E1E1H5FHL$XEH|$L FI莉IMqLLIHL$X11L If IO1LL]H|$H=1$Lj_t$8LYBt$4L%LH=1H5L1H=1H|$L 1FIޅIDL$EDD$H|$ AAFAAHcA@AHH9HBHL$8 HL$8H|$AHH9HCHL$8HL$8LAHH9HCHL$8HL$8L\$XLL\$8AHH9HCHL$HHL$HH52HAHH9HBJDH5+AHI1ξLT$PMDHGHLLT$HRHt$MDHGHRHt$ MDHGHRHt$MDHGHnRMDLHGHVRL\$8MDHGHL9RH5@H1DDHH5A1DDHH5YA1DDHH5A1ӽH5AH1½H5&GH1豽DDHH5!B1蚽H5sBH1艽H5BH1xDDHH5B1aDDHH5 C1JH5cCH19H5CH1(L\$8LT$HH=!H5FAH|$(־H=! L\$0LT$8'f.ATUHSHH{HDPu[]A\IHtH3 uL$%H=tHSH}H5t)1aEEtH}[H5S1]A\=DH}H5+i1&Ejf.AVD4AUAATIUSHA9Hcx1IcL+~YE1If.IL9t7B+IHDPtSDHLAuIL9u[]A\A]A^H= H5I1[nfDH=H5E1;[1]A\A]A^H=H52I1Ic+AWAVAAUATIUSHH>dH%(H$1HDŽ$HDŽ$HDŽ$DŽ$诋H=.EHIvLD$HHBLDHE1轋D$8E1HJD$lIL-HD$0D$D$(D$`D$hD$D$@ HD$ HD$PHD$pHD$XHD$HHD$tG|wHcH@#w͉7ѓuDÜc Ht,H  H%H= H${ $u DŽ$|$@OMD$BD$@PADl$E\$L$ۉD$xH5CDDH5CIDIMھrLkHHH|$ MtHttHD$ H|$HT$xH|$PwSkIH D\$hEDT$ELt$E1H\$PHGHD$ H Ht$(HD$`8 L$ H|$pH$HD$pH1Hz_|$0 H|$H5FHuHt$pH|$ H5BH=1*D$1D$ffDD$1fH=LH5C1LH57H=w1жD$E1E11E1E11H=QLcH59CLdH5%CLHlLH\LTH|$ZOH$mH5BH$dH+%(FD$H[]A\A]A^A_@D$;1H!MHD$H$H;H$fD$D$8DŽ$'fkH$H {D$8fD;H$H kFfDHD$XQfHD$p911fےHD$H˒rHgHHH5HD$xWH|$xD$ T$ 6 HcHHLH)@@HH9WP t tHRHD$ pHD$ Y HHD$@1Ƀ~HT$@HH€:kuL$@ՑH$H赊H$HL$@tHH9H H$D$@@D$cISHD$Pf;I{D$kH=H5=1HH5=H$DŽ$H$XH=H5_1ӲD$E1H=)4fD$`D$0D$hD$(D$(D$lD${D$0kH=92LD$H=L1E1H5<E1E1E11D$HD$D$x L$@AHcHiVUUUH )HcHi*H#)DdP)E11H$LbH$HHD$ HIH(DL$hEzDD$`E|$-LLH\$PHD$L=}HLLLwH5pHH5aLL$L5;H;H\$ L$ ɉLD H蓺LMHH;1AELL`uA}H\$ tkLl$ T$@H=H5%;1 %H=H5:1]HlH=xH5,;1H\$ ůD$1E1E1H$sH\$H\$PLt$ Dt$@L|$(L|$Hl$0fLL9D11Ҿ Hu11ҾHuDLHŅH|$11Ҿ H\$Lt$ L|$(Hl$0D$*HH=sH5;;H1®LJH=SH50;H1袮D$LH5 =|$8d1H=H5 =1HT$8_H$AHPH$PDD$pHL$0HT$HH$AYAZKL9l$ Ht$`H|$ H|$Xt'H…!H=H5<1ӭH|$Ht;HCH|$HH$.H|$HH|$HH;H#HD$ HH1H$DL$E11H$1HbDD$lH$EH$DL$11L$HHD$HLD$8xt$hXL$0t7T$(CHIHe|$0Hl$ Ht$HTH\$H\$PLt$ Dt$@L|$(IHD$Hl$0D$1E1H|$XQH#hH=H5A811$D$_H=H571H\$Lt$ L|$(Hl$0D$)HL薾Lt$HD$PH|$XH$H=FH571蘫D$LH5t6|$8HT$pHHD$88HT$pD$xL$ ARD$@$LT$xPL$D$t$pH|$0聪A[ZLT$pRHcT$8H$Lֹ@LT$8HT$p]HT$pLcD$xH$LT$8I4L5H=I1E1E1H5蕪D$D$1H=H561dD$BH=LH55H17JH|$PH$H$H|$PHHD$pHSalted__H9$VH55H=d11軩D$H57H?H58LcL._HH=H55H1RH= D$Hl$ |L7 1H$D$1D$GH54(H= H5G51ިD$H=j H541輨D$H=H H5n41蚨D$H|$ H5H5 H|$ {H9"H541色1H\$H HD$8H5M<1H]H9Կ H\$袴
41*1H\$H HD$HH5;1HH&9Կ H\$CH531˱H$Ld$IH5;HH1H蛱H;\$8H5k;u߿ HLLd$سRH52H菴HD$811҉D$xD$Hl$ ,f.DAWIAVIHAUIATUSHI.IHPHT$ AT$ H~ED9Hc۸, HfHkLHH[]A\A]A^A_9~A$HA?DHH7E0E'IcHHI.AH56AI@0A?1IHcf.H?HH60AHc&HHtI. fDI>AH5h6I1ff.ATUHSHHdH%(H$1H9t"H$dH+%(uPH[]A\HIH5LH1|HsH{LuCZf.AWIHAVAUIATUHSH8dH%(H$(1+D$gLd$ .DLH5o5H1DH9\$L:HIHIM)AIcҹLLLT$HD$\LD$1LLT$LIPBD [LH54H1蟣9\$cH$(dH+%(H8[]A\A]A^A_f11LLH$(dH+%(uAH5n5H8H1[]A\A]A^A_ H$(dH+%(u H55AWAVIAUAATUSHdH%(H$1AH9I1H$HTHMHD$/H&IvM&HuHIAIvHt>-uM&H<LDH6sD$ D$D$D$fDK|t?|wHcH@PwЋL$c9MD$fDބH0HHu##fDHHH3H>-uH=LH531cH=LH51HAH=HLH<$H|$#H$dH+%( HĨD[]A\A]A^A_D$ D$D$H=I;E11j@~H<$Hf{~LH{H#E1D$$Hl$(Dt$4L|$8L|$@H|$(9D$$ t$$H|$(HIHHWHׯLH5F1LH1Ht$8LH0HLHQDt$ErDd$ED\$EE111Ҿ HE111Ҿ HLcEHD$@HD$0Uft|E1E1H5!0L袸H5 0L莸LE11ɾ H艿LcEE11LHhÅV|$D$HuE11LH;+xH5j*E1LHHI }E11LH`ADT$0EH5L药|$ MH F/LLIEH511|$D$0H 1H5l/LHНDL$HE؉ڃD$H؃D$031LH5M/1|$HD$0t&H5)/L1ZT$0L1H5!/E H54JL1,D$0L$0~H5JL1H|$@H5-1iH5-1VfDHD$$vfDH=QLD$4L$4ND$4fH5L1L$0IHHLHͱHtH,HLtgH躙H11HT$hHЅlHE1L,@IM9LHD$hB<0HLH_uL|$8Hl$(Dt$4~LL$0L$0ȃNeLH59TL1L$0ߚL$0ȉD$0L1HH5 T踚H0fLH5+1藚H4$HLHxH5+|&E1LHHIML|$8Hl$(LDt$4H|$@HߺH5+蘳H5+L脳HGHtP11HT$hHЅ~>HE1L, IM9t%HD$hB<0 HLHuwHHtz11HT$hHЅ~hHE1L, @IM9tLHD$hB<0HLH{uH5*L11\$ УrHt$pH=Hl$pLd$xH$DŽ$mD$EH|$`Ht ?BH5)8IH7fLȗHHL5IHu L|$8Hl$(E11Dt$4)t$HH5*L1B\$0LH5)1%H5)1LH5)L1T$LT$L&DD$HEuwT$0LH5)1ŗT$0L1H5)谗nH5R)L1藗H5DL1聗H5FLҨtH5))L1ZH5!)L1I\$0t$H5(L10H5(1LH5(L1 H=[L|$8Hl$(LE1Dt$4H5z(L1˖H5(L1谖D$0bH5m(L1茖JHH5'L1sH|$`@AUHG2ATUSH(dH%(H$1gI|pAąteAt?AuH=2E1yH$dH+%(H(D[]A\A]fH=yLH5(1A•xH8IHtH\$Hl$@AI}IHt1HH5+*Ξt1 H|$H輡H=H1H5hLDf.AWHw1AVE1AUE1ATU1SH*H(dH%(HD$1H$HD$HD$=fIf.oDžt%|wHcHfDwAwAEfH=L11H5E1E1`H=AL6LNHH.-H|$H5!)蘭HD$dH+%(6H(D[]A\A]A^A_f#1E1E1gvHH ifDq1H*HfkqI[qIH=/E11E1vE111HL$LL DLrFFIH111HHHLE1LTIHy11Ht$HH|$<='H|$E1$H=-H5m'1}H赦 H1E1E1t$HT$HLE1zZYH=H5(O1E1H|$蟦H='H5T1MH=H5&1ME1ӑnifATIUHdH%(HD$1D$*<1LHuKD$.Ht$H11Ҿ HHD$dH+%(u;H]A\fDu D$+@uD$*랃uD$ AVAUATUSH dH%(HD$1H?HD$t=H=~H5&21H\$dH+%(H []A\A]A^HIH|$INIHuMMME1111H|$ H|$|$ LIHt,HDžu~L+NfDH=LH5v'1H=L31 @LLȶIMHH=ULH5%1褏18AWH,AVE1AUE1ATU1SH(HhdH%(HD$X1D$4HD$8HD$@HD$HHD$P`D$HD$Ibit wHcHDCrÅu H|$@LH5/H=o1E1H|$8H|$@L1H'H|$HH5X%HD$XdH+%(Hh[]A\A]A^A_f.kqHt$PHcVEMH|$PÔ%HH|$P誔%HH|$P葔%H=H|$Pv%H=nE1DD$H|$@AzH|$@okH|$@H6SUkH=LH5%H1JH=H|$8E1q@kH|$@DHHfDAjL|$@MH5"H=uE1(H|$8fDjIjHD$f{jHT$4H)_Z@Sj1H#H:H=)1E1oH|$8zDHH5PHD$|HT$HH1HT$(HD$ jH|$ HD$H|$HT$(H|$H轖IHt5HHD$ xLD$ ~H|$LD$ LD$@fDH=)LD$H5!ӜH= LD$L誶H|$0H|$811HT$HL<t$4H|$DLIHH|$@H5AH5H|$@{H|$@Ht$8EHt$8L.D$H|$8H11LE"H|$8H5 H= 1fH|$8LH55"rH5!H5WD$4=u/Ht$8LվBH=LH5F 1H=|H5d 1ɉH|$8H=XH5^ H=@;AH1E1E1t$PHT$`LHt$H ZYH=H5 谚H=H|$8\${H=H5~H=H|$8MH=H5lDRH=H|$8!wUHHdH%(HD$1D$*uWD$.H肏Ht$HHh11Ҿ HHD$dH+%(u0H]@u D$+@tuD$ ҼfAWAVIAUAATUSHXdH%(HD$H1HϱD$HD$ ID$HD$(HHt|HeH5HAH!yLDH,XH$E1HD$Ia | wHcH@1E1E1L`H(H@L8L H|$(H5芠H=HL$HdH+ %(HX[]A\A]A^A_fDAEDA5H=NH51蠆H=9L11H5E1胆6fDH=1E1iLHGH_LWL?H|$(H5詟1)f dHt$H]1E1@iHt$ HV[^@cH$Jf.cHD$1c1HIf#gDhhH4$11HL$(6YH|$FIHL$T$1H5H=MLHHLL\|T$t$ILH^^HT$11HH|$諵H|$H$-L$IMt$HtH=LH1H5.QL$LǺH5&蹝H5L襝HD$(H1L SE1HLHD$8HD$HD$@HD$8PHT$0苻ZYz@H=qH5.1E1sH8Ht$N[L$@CH='@H51t$1 #H{fDAWHAVE1AUE1ATU1SHHTIo]wHcHfDH=L11H5DAE11ۂHL۸HCHD[]A\A]A^A_Ð`H\ueurL5HHwH5IHDEHH^ĚHEHuKfD[1H11H}HHuH=LLH5xہH=tof._IADH=IE11E1 e11E1A111HG1HHu4lH}։T$ 9LIHLL耔T$ H}T$ T$ 9|41A'HLE1脝H=LL1H5A΀H=gbf.=:f=ou@1fHSIHFIA91HY1[ff.fAUAATIUSH~;HH,f.HCH9tHË;tHCH9u}H5LW]D襉DAUATUHH|$ H$PH$XL$`L$ht@)$p)$)$)$)$)$)$)$dH%(H$81Ld$H$HD$ H$@D$D$0HD$(umHH=H51~H=zHLoH=hH5+1~H$8dH+%(H]A\A]fDLl$0MILΔ|$ 4uW@|$ 1LH7|$ ~Ht$ H=n跲AWAVAUIeATI1UHS1H(dH%(H$1HLYI1MLç|IEHIH$H$L)~D$GET $POSTH$H5X1|~1ѭ7lH$dH+%(%H([]A\A]A^A_f1ҾiH kLjsH$Ln~$GET E$H$< q;fD[FHD$0!KFI;FHD$+F 1H$ FH$pH?fDEH$xH?$E$DEHD$8yfEH$^fDL$MrEIHH$HHHD$P肇1LHD$mHT$LL$PHLHLHD$譳LD$IL蝆MtH|$ L;H=H5 1fD$1QH|$@fDH@HeHD$@HL$MHH$6Ht$@LH辠IHJZD3DHdHHHrH|$XQH|$XHJDCH$fDCH$fDCH$~fDCH$ffDCH$Hk<FfDkCH$HK<&fDDŽ$DŽ$+CH$fDCH$fDBH$fDBH$fDBH$fDBHD$yfBH$bfDŽ$PDŽ$@DŽ$DŽ$%DDŽ$H$fD$EgBGH$H9fAH$L菱HALHE1Q|HD$XH1HD$E1HDŽ$HD$0HD$HD$8H$HD$PHD$(D$肳H$HN@cH$H/DH$H D$H$VH$BH=H501bH$I0B{HD$`H躍H$IH=#L1E1HD$(H51hbH$HD$HDŽ$HD$0HD$HD$8HD$PD$$H<$D$HrHHtNH5NOH=oN1HcHH$襧H$HH==H51aHD$E1HDŽ$HD$0HD$HD$8H$HD$(D$H$HD$(H;3H~IH<qH~HH1ɺHrHHL$(vHRHLvH411ҾeH#Hl$(HH51E1HE11rLJD$HD$HDŽ$HD$0HD$HD$8HD$(H$HDŽ$B H$D$1E1HD$HD$0HD$HD$8H$=H|$(t3$H5VH51H$L$HH$(H$HD$0HD$8H$hfH|$(DH$HHsH$ a{H$xH9Cpu-H$H9uH$(H9C uH$ H9CtbH1腌H$1#HHtHv H&H$H51$HT$(H$H$HDŽ$H$H $ H$H$H$HHHDH$HD$0HH$t+H$1H$LH$E111L HD$8H L$L$1HT$8Ht$0H$<$tH$Ht H|$P1@H$Ht=wHHHH=IH$H^H覢H<$SH$H$HDŽ$$xH$H$PH$H$H$XHH$`Lm$$踩11H$0z$HDŽ$8H$@tk<11Hc8tH$8DŽ$D$H$\Hm111H$(IIZH$^fHmIH1E1E@DH1SZ1LH趕LHILA']HߡA9|BHE11ɺ$@L$PLH$@sA^A_$$9$$H$H$0cIH/LD$H$X1HH$hPjHl$`1(HeYH$HIrH9|L$H$PLH$H$0C@ D$E H$01+HLH$@]H$8]H$0IH$HtHH$Ht8wH IHv H=JFHHL_H[Aą$L$M$pt$p L&H$HDŽ$oHHDŽ$@H$M111:WH$1HDŽ$ HDŽ$(HDŽ$0HDŽ$8HDŽ$@HDŽ$HjIH= H_gH5LH=!oHLH$8LH$H$ Hxb]H5HI{qMIE!tjt=uH=iE1Q*HD$(dH+%(bH8D[]A\A]A^A_H=ALH5u1AF).)AŅH=51H-5HfEw @a9LH}(H Hu޸OD$ H=1E11H5L=#5EH=5uoE'H=nD9H51DEH=MEIO1H5I EIDEt$|$ uH=H5T1OEA9tHo(HHD$ HD$HHD$=HT$H+A2H=EYH5a1ADH=u8H=iH51DfDH5i1ADH=5H=)LH5_1ArDD$ 'LxfDUHHt'RC苉HH5P]H1&DfDHHH]HDHHD1HHH5 CUHHt'R+HH5]H1CfDHHH]HDHHD1HHH5CAWAVAUATAUSHL 2D$E1M1L52L=JMؙ|$utH5(1#CH=ħINDL1CMN(I Mt3A9.uH=EtLH51I BMNMu@EtsH[]A\A]A^A_@Mt[E1LH1fDwLL$]LL$A9DLH{(H HuӸOAAD$DH=HH5;1[]A\A]A^A_-Bff.fAWHAVAUATUH-S1HHdH%(HD$81MD$HD$+t HcDH %u&HT$H=<H5p1AHL$8dH+ %(HH[]A\A]A^A_fD1Ld$0L5mL-oL=pGf|$WKH=إH5\H1A|$ 6KH=H5EH1@|9uHL$(HT$$MIHt$ H|$heD$$uHT$(H=]H51@D$$LH=@IEH51@|$JH=H5H1e@HT$0HoH=H51B@?DaHHE1L|$0Lt$(L-.LLLH|$(JH=H5H1?D$0HH=nIEH51I?L9uffDH.L%.L-RHBI\$HuGHDI9D$tH=H5"1M?IT$(I HI\$HtH HuHKHHtH{uIT$H=L1>@H=H5_=PH=~H5b*PH=kH5[PH=XH5NPH=EH5@OH=2H53OH=H5%OH= H5OH=H5 ODVfDH5ѢH=2͋t$zH5H=}BH=-IHH,H{(H HLwsuH[HuCUDH}H9t)HuH9t:tK H=H561[=HHHu f.t$Dt$DD$H=i~t L|$0HH=pH51<DH=QLH51<[6qfDAWAVAUIATUH-͡SHHhHT$L|$"dH%(HD$X1fWLITWLLILl$'謄LD$ LL藄LW)HD$MH5HGIwg)LHG)H5kHGH)LGHVHw%JD%HD$aHHf.E11H5_1TLPyHHy1HL$XdH+ %(PHh[]A\A]A^A_HL5GH-VHwHl$=aHHtO1HH:LHHmRmMtNH5dHLRLLLH6R6H52HRHT$LHR`IHN1LH9LHLQHT$LLQLHLQL|$01LLTfDAv0LHL$LQ9L$w؉LH+QDEt2HL$H5HDPL$u1LH,T/D$LLPiD$=UUUUiD$m۶=$I$D$LLfPS1LLS>D$D$= M1LH38D$D$JLHGE1LHwDHT$LLO3LHLO(1LuHuH|$@LL$N1HAHcȃHHIL 0JH$)I9uD$5DD$;H5ZHl$Hl$D$NHULMDD$OE$ODWHHH?BBAH$1LLD$(HHD$ MLD$(HD$L $L97H\$@H\$ Ld$0IHl$8L@L)I9LHL>JuLD$(Ld$0E1E1Hl$8$ht%t!LfAEfH5xH1O2D Ht$PI}|HL$P1Ҁ9$pD$ɚ;LiH=ɚ;LD$^LLLt$`LD$ fzLLVzLL$L|H5ZH=HD$w=LD$ |H=aL=|H5H=F=DD$L1H rPatL|H=M=|H5H=5=Af.E1E1E1LL $nLnL $H5L[JH5LGJH514J1DI7LhHD$pH="H5S1t0}wL=HD$ HgA~H5CHT$D $?HT$D $HHIE1E1E1E1H=CЉT$E1E1IHt$ LH\$@LLd$0Hl$8KGLD$(tH $H\$0LILD$(HHT$Ht$ HGHt@uH$LLLD$(IH\$0Ht$ 1LLD$('JLD$(K1LHLD$(.LD$(3H$HHl$(LLt$0MIHHtrH$LHqFuMIE1Hl$(E1LLD$(IE1E1H$Ht$ LLD$(+FLD$(H<$(LIMHl$(Lt$0H$1LLD$0HHD$(,ILD$0PH<$LD$0H5_LD$0HIMHt$H$H9H|$(LAL7Ht$(HzHHH IJJLHH)H)L$HH|$H)HH9rHt$(H1LHLL$8LD$01-LD$0LL$8$Ld$0MHl$8HLHHD$@HT$LHDlHl$@uIHt$(1Ld$HLLd$0HLD$0Hl$8GH|$H5^LD$0LL$HHIH1Ht$(L$Ll$(MLd$0IHl$8LHT$Ht$ H/DL1HHL1HHH|$HHT$Ht$ HCHt$ 1HGuD$II9sn1HH+SLHD$HJH$LH1;`H$L#MHl$8Ld$0IE1H$L^IL,$Ll$(LLd$0Hl$8iL}iL $H5mLDH5YLDH=*eFHHA$56"$$H5 $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$$ $ 1ɉ?<>@|)HHu$$ $ 1ɉ?<>@|-HHu$$ $ 1ɉ?<>@|1HHu$$ $ 1ɉ?<>@|5HHu$$ $ 1ɉ?<>@|9HHu$$ $ 1ɉ?<>@|=HHu$$ $ 1ɉ?<>@|AHHu$$ $ 1ɉ?<>@|EHHu$$ $ 1ɉ?<>@|IHHu$$ $ 1ɉ?<>@|MHHu$$ $ HL$@?<>@|QHHu$HH? HUHHWPVHT$LHQ=8IMLd$0Ll$(Hl$8H$LH =$$H5 $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$HL$@?<>@|)HHuHH,H!ff.AWHgeAVE1AUE1ATU1SHHH dH%(H$8 1HD$ HD$($D$ID$D$ D$D$D|wHcH#w͉uf.AE11H|$((H5O;L)H5;;HgH$8 dH+%(HH D[]A\A]A^A_LH5PH=1h!sD$ AkH8HpuMT$"rL*HHAHHD$E1D$DhHD$(HD$DDLHZ9 LH\$0POHEHt$ AVLLt$D$PD$PDL$(HT$8|$,rH uAZD$ IfDH=bE1E11t E_A@EGA@$t@D$cD$FfDcD$ HD$ )EA@EA@EA@EAAHDHD$H+E1HD$(Ld$HDd$Ll$ D|$HD|$ @H HAVLCEHt$D$LDHPD$PH uLd$A1yfD H MH HH6HT$(Ht$ AVLt$D$E1LPD$PDL$(|$,H ALH5eHHD$A1Ld$D|$HH5I褩HD$IċL$ L$ HL+L%ڂLHЂqHteHD$A`H5 A+ HD$IQH5HD$IH5 AڨHD$IfATUSHtWHH=HuAD[]A\fDH8?AątA[]DA\ÐE1[]DA\DH=ـHH51(fDAVHAUATUSH dH%(HD$1Ll$Ld$Hl$LLH,H|$&lj%H=jH5H1|$tNH=?H5,H=,H5,HD$dH+%(H []A\A]A^H|$H5ܤiHHtHxF@H=H5H1H@|$_H|$H5IDiIHBHLLH+H|$%IN11H+H|$q%_I$H=9LH5H1Et Lg|$H|$H5hIHHHHt11H*H|$$]_I|$I?H=~LH5>H1L0d|$H|$H5ɢhHHHx>H}I>H}H>H}IhMILH= ~H51[HNMfATE1UHSHHAbP111HZHHuEuD[]A\#D[]A\ff.AUATUHSHt,tvHH5A1[]A\A]fDHFHX~+BL%LlLH1HlL9uHHH5W1[]A\A]L@HFHX~ӍBL%LlLH1HI9uDHFHx0KHH5IH1HLy[H5E]A\A]D1@AWAVAUIATIUSHHKHIH^L H5L1E1yHLLe'L1H5TH H5L13AL]A9DLHHHI!H5L1r LH5H1Hs1H!LHHP9|TH52LqH[]A\A]A^A_DH51JAWAAVIAUATIHUHSDH(HD$`L $HD$dH%(HD$1-VHId=]=*=-DHD$dH+%(gH([]A\A]A^A_fD=}|LHQLE1HHdHpLLHDLAHH HL6HIH :H7LHvHaHLE1t$HT$E11LbLS^_JDH=wH51jfDH=qwH51fDH=QwH51HHHt$1HUH|$bDH=wH51cGfD1X`FAWIAVIAUAATEU1SHHLL$>f.HHDLt$XLL$HELZYtHtX9|H[]A\A]A^A_ff.AWAVMAUATEUSHH(H|$HKHD$HDH|$D$D$X9D$fDH|$t$"HxIt$HLIME1Cf.DLHHt$hH|$HMEuZYALOWA9|H5+LTH|$D$,W9D$2H|$H5 D$TD$H([]A\A]A^A_DLG|$IDž1H=t1H5TM1H=tH591IE H@HxDH5aLD$SD$GH(1[]A\A]A^A_AWfE1AVE1AUE1ATIUSH|HdH%(H$1H$$$DŽ$DŽ$HDŽ$HDŽ$HH$ H@LHDSH$1E1BD$|HD$(DŽ$HDŽ$HDŽ$HD$pHD$ HD$D$xD$lD$D$hD$D$`D$dHD$@HD$XHD$8HD$HHD$PHD$0fktG'|(wHcH@#w͉)uDMEH|$H$H$LdL$M DL$`L$DŽ$EM Er HDŽ$HDŽ$C D$ JT$ RH|$8A H|$81H$Lou HD$1H|$H|$@!"D$xT$ D$0Hl$812L H$ރHq HH!DLS9|ŀ|$ Hl$8 |$0 $P L$` D$HPjD$xP$PD$L$HT$8Ht$xH$ H HHH|$pHtH$D$t%HAE1$1LHMXZH|$PPIHtHHHHD$E14LT$H|$LT$1LH5H$mOH[LT$E1E1S;H$H{1HT$(1E1AH=oH59: E1E1HLT$L\$XL軣L\$LPLT$L@LiONH5L$H$OH5#H$PH5#H$dH+%(HD[]A\A]A^A_D$D$H=9N1E1E1\E1E11HIifD$|SDŽ$@KH$.fD3H$fDI HD$ D$hADDŽ$D$lD$`D$dx{HD$akHD$PQ[HD$0AM BLH?"f+HD$@HD$X HD$8HD$HH$H;fDH$HfDHD$pHDŽ$oD$x[D$KD$;D$+IH"DHt$ H$H$LcL$zHt$ H|$H$H$/EtAD$ D$dD$ HD$HMH$L =HHDD$0H觿HD$Ht1H|$8Ht#1H$L|$ j$T$|H$H$IHHD$0ALT$0HHy1LHLT$8HD$0BH|$0LT$8PLT$8H|$0H|$0LT$8*H|$0H34LT$8LVHHl$0H݋\$ H[H$HHL$@H|$A)71E1E1A|E1]H$H$IL11Dd$0HV(11H8H$4HkDH=e111H5[E1HD$^HD$1D$0D$ 1E1ALHLT$L\$0L\$LT$1LH$EL\$LT$HH$LT$L\$HD$8H|$4H5ILHg0L\$LT$LT$L\$H=td1H5{|$`L\$H$LT$IDH$H=6dH511Dd$`E1E1LT$ .LT$L/BH=c1MDd$ E11ɾLT$H$H L\$? L\$LT$H=cH5q1E1AL\$LT$ HLT$L\$L\$LT$qIH$H$H$H$A9}HH|$D LHƋD$Ht$u葋Ht$E1L: ;E1H<$uH5LA H<$\>A9}H<$DHD$血Ht$LH14EuHt$L/,AWH@E1AVE1AUE1ATUSHHdH%(H$x1D$4HD$@HD$HHD$PD$8D$<HD$XHD$`HD$h-D$,D$IHD$HD$ HD$K|wHcH@SH+Ņu@H=ZLH5H15DH=ZLH5x%1A11E1E1E1HLT$1HDLT$L6LێL+L;H|$HcH5<5H|$PdH5&H$xdH+%( HĈD[]A\A]A^A_#zs:DH|$HL$PHT$HLlO+T$8H|$r(IHt$HHLT$HMLLT$w LT$HHLHHL$HH|$ML ڋNIHHHD$5LT$HHD$D$<=dH=yU1LT$1H5XDl$LT$11E1AH=7ULH5TH1NH=U111H5eDl$E1SH=T111H5ӆA9E1,H|$@HLD$XMtLL$`MtHD$hHt$4E1A11LT$LT$IM)Hl$PHHLT$LD$ LD$HHHLLD$LT$HHED$E1|$A|$@L\$LLL$EL$L\$HT$H5#H=;1E1E1E1HT$H5&L\H=H;C%EHT$H=.;H51LSLHT$H=:H5y1GH=:$H=:H5 HT$H=:H5k1 LD$`HL$H1҉LLT$L\$L $L\$LT$rHT$pE1L $HT$(mE1E1E1һHT$H=*:H51|'L$L\$ULALL$L\$L$L\$%H=9LT$1L$#L$LT$HT$1L$H=9H57LT$L$LT$LT$H51L$H=b91E1L$LT$H$H=:9H5K1H|$pH5LT$H5L$E1dH5LT$L${LT$H5ɟL$_LH5L$E1rL$L\$f.DAWHrE1AVE1AUATE1USHH(dH%(HD$1HD$D$IwHcHH=8H5L^1jf.H=7LH51ABH|$X"HD$dH+%(H(D[]A\A]A^A_f1 HE]D3D$ ET$ HCEHD$HHT$E1E11DH|$EHHH= 7H1E1H5qMjH5H@D$  1HAg@AXDAHDH=pE1Q@H0Ll$L5HukektHt$H=36 H|$11҉H HH= 6H5@IE1HMH3HLEuH=5H51HH=5H5͟AH=5LH5<1zH\H=f5H5J1qH=L5H5@Y6fDAWHWpAVE1AUATL%U1SH8dH%(H$(1D$觡I@苪ADžt;D$ gHT$0LM$%=.LHHHH=L5Hpt#IHL9aI>HMuH5LD$VIH111LLLH HHp AƃqH1H8HHD$PL$E1LD$P1LH54HD$HI8LT$HMt|$X-D$\$H5H] D$tpt$t;t$ J\$XH+Ll$HHD$`HD$`HHD$HHD$tL$HD$0HD$ 1LIHAWHD$ӃHcMgMaLfHf9vHʾH0H3A4HHuLt$1Lt$H]A|$dFI|$H5iH5XLMA_MEL$M,$fA9sAGH=Hct$ HAOLL1a5S2tIT$H=S)L1H5X_jH5͔LH=)H5D$XH|$hH5 H5LH$XdH+%(AD$XHh[]A\A]A^A_H5];Ht$@H|/HpHEHT$@.DHT$ @HӉAADu߈D$ AGHH=D\$0Hct$HRU4AGLPHL$X1LL$PLD$` 0H DT$ D\$(LD\$(DT$ YDT$ D\$(>I|$LD\$(DT$ DT$ D\$(E DAGHct$ H=HAQH4AGLPLL$P1LD$`HL$XQC0H _LY*8IH“H= 'ILHH531TD$Xf.Lt$H5sLH|$CHD$`H5/HHHD$`H9Ll$H@DT$ D\$(8D\$PDT$(HD$ LD$ LH=E&HH5s1D$XD\$PDT$(YHcL$tIT$H5 1H=&LVD\$(DT$ fDHcT$tH=%H581L#fDD\$\DT$P8"IL$HD$(HL$ >LD$(HL$ H5ΑH=v%H1D$XD\$\DT$P1H5HtLL6+\HT$8H=%%H51oHT$8H=$H5ɐ1PD$X莑H=$LH5H1#H5HDZL1H=$H1H5HT$8H=y$H5hͿD$XZHxHtQHD$PL$LD$P1LH54-HD$HIxFLT$HH=$H5f"LLLDHAA D$D$X LLT$HDLLDHAALT$HD$@AUH_ATUSHwHdH%(HD$1IAąt/AAwJcH@,ɘAąuf軡薡H~HH+H;+HDH H;AHu?ƿf1^fKfDH=^E1aHD$dH+%(HD[]A\A]H=Q"L1E1H5蝽HHHtk:H\$H5fD$HHIHHt)1HAHHuH5lL: HHD$dH+%(uH[]A\A]f.ff.H5?ff.@ATIUHdH%(HD$1D$*,1LHuKD$.Ht$H11Ҿ HHD$dH+%(u;H]A\fDu D$+@uD$*랃uD$  ff.AWAVMAUATIUHSHH8H $dH%(HD$(1H 0< H=LM|$ty:L?HD$HAE)H|$ DLIHHIE1111H|$ uHD$0LxHH5LdIH@1H^IH:LDmLAI4A9uI% 1VuE1HIH|$@ IHtMLD$ 1111H|$ H5H $H|$HLMLLI艼LHHM3LH5}u IHD$(dH+%(PH8L[]A\A]A^A_fDL:D}0I|kIEf.LhAE1DL証TH5fH=tH=LE1MHHǺ 1H9@H=iH5:H=VQ@11ҾL'L111YHHtqHD$H|$I LRMfH=L1E1H5O5TE1IL;E1DLfDH=H5:M H=yH51E1ȷLH=QLH5M1蠷H=1LD1H5}AWAVIAUIATIUHHSHLD$YLINHIDL9w9LLHJ|=HSLH[]A\A]A^A_fDHT$H=L1H5x۶H1[]A\A]A^A_f.AUATUSH(dH%(HD$1HD$Ht9HIHt$ IHHtzIHt$1LL1#uH1HL$dH+ %(H([]A\A]fDHH|$HI._~2H9|Ӹ@D$ LDr@H=LH5#1еH=id`Zf.AWIAVAAUIATEUHSLH5:#H=#11Ҿ HLD$@HHH KbH=HH5Nl1(< <.5HHcЀ| gHcIA9(Ex D9"H[]A\A]A^A_fDH=QDH5o1蠴J"ufHuaH=*LLH5'1vH=f. "u;HHHfD1H[]A\A]A^A_ fMt=A}t6LD$HLHH `xfD{ H[]A\A]A^A_f.H=IDH51蘳H=)H551{1F@AWAVIAUIATUSHH|$ HL$(LD$8DL$4dH%(H$1D HD$ELL|$PAą;L9L˱L`HLHMDH=|L€tH=fL€tH~It H=5€dItH=TD@A<$@Lt',@<:BH@tބELED$0@+u D$0ILAąHSL;MdLH A59H=ZLLH$HHSLLdLH SsH=LL9HD$HqHSLLdLH ,H=HL$@LLMHSLhLdLH fH=HL$HLLDD$HHxL$H{PHoMPL$PHT$Ht$LT$ AYAZvzHADAD$8PLT$ $ H|$(L_AXAą3H$dH+%(6HD[]A\A]A^A_HE1H|$FAąH|$(t D$4ADSHD$@D;AHD$HH=H51bH=H51MH=H518H=H521#H=H5]1H=H5x1H=H51芹H[H$HuH=YH51諮{H|$(L~5B}Hl$(Lt$8E1Ll$P3fD$t$0LAH|$ BAąAHD9zDHL`HLD$0tLILdLH 1H=LLH$HLBILdLH O=H=^LLHD$HaLHLdLH 7wH=HL$@LLhLHLdLH 2H=HL$HLL#DD$HH؀L$H{PHրMPL$PHT$Ht$ZYIjH=EH5N1藬gf;HD$@=D#AHD$HiH=H5\1JH=H,YH$Y϶D$02H=H5߆1H=H51TyfAWIAVIAUIATIUSHLLLHHÅ~ HL Hr1H[]A\A]A^A_ff.AWAVE1AUIATE1USH$HdH%(H$x1HHDŽ$HDŽ$HDŽ$HDŽ$ HDŽ$(HD$@DŽ$DŽ$DŽ$DŽ$HDŽ$0HDŽ$8YHBLLH${D$XHD$HHDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$(D$\D$THDŽ$HDŽ$HDŽ$HD$hHD$pHDŽ$HDŽ$HD$`HD$xHD$ HDŽ$HD$HD$HD$0HD$8HD$胃(|)wHcH#w͉'uf.HD$HHD$@E1E11E1HD$(H=^ YH=r]H=^QH|$ LHH$ZLH|$8H|$.H5L_L臿H|$0=H$H5y{H|$(LH|$H|$8@H$ H;|$@tH53{^H$(H;|$HtH5{>H$xdH+%(HĈ[]A\A]A^A_ۊÅaHT$HH= H51fqD$(DŽ$[H$H|tH$H$fDŽ$D$(ۄH$fDÄHD$xf諄IM I/@u%@IoI@IHDh u߾=L2HHLH5yL)诽IH HH9s$HHI9 HEDB uI9 ELLHH H57yH_Zf.H|$诃1HuHD$Ho"f苃 1HLD$\KDŽ$8[H$&fDCHKHD$0HIUH= H5Ny& 1HA<HD$8H$HwYf軂H$Hfwv)fH=IF1E1E1 1E1HD$HHD$@HD$(KD$(I3HD$hfHD$p H$fDH$fDہHD$`ˁH$Hvv9f蛁HD$@iD$T[DŽ$HDŽ$8[H$&fDCH$8H3fDH4fDHDŽ$D$XDŽ$DŽ$DŽ$xDŽ$hDŽ$X6IH|$F_H|$H"DH|$/H|$HrDD$TT$\$$ttH=H5T}1L$TȃH|$`@ň$@ Bl$(Ht$hH|$pH$(H$ L$RD$XOH|$@UH.IHH|$ @D|$XEH|$ 1,+HIHHD$@H9L=tLeL=ML+H$PH|$xL$@11E11AL:H5cLHT$x1LH=J赫 H=-tNL$@11E11ALH5L襣H= 1LH t] H$ H= HD$@ H$(HD$HV HvH5QIH- H'x H$/H=f H5H3HHH=HD$hH$z L$@11E11ALŸH5 L膢H$1LH= = H$HtLLD$8$1HH$ L 9WH$IH^H=x H5"L$MD@;H=K H5L$0H=0 LHrH5z HDŽ$0MTLD$0LLH$H$-IHS$H$0Ht{sM1H|$tFALl$(H\$#H袜LHIF HA9|Ll$(D$H=H$H5r1WH5LH5LH$LLiH$H=H$H5{11ҋ$MH$^HHH=~ HqH5!H8nu xouxHE$H$D$EHD$E1H$HE1E11$0H$HH$AYAZm%m A 谦Af.H5 H=}I%HmHD$ Mt H HD$HHD$@HD$(E1E11E1f.D$(HD$HHD$@E1E11HD$(ѳHD$H蹳HD$HHD$@H;1HLHH5_H;IHtLKLL=|H=pHkH5HD$xH:H=>HH5[HH H$"pH$H$`DHT$@H=H5{1L wH|$ H5QH1HD$HHD$@E1E1E1HD$(H=IH5蝙H=1H5"u1胙6HD$h H5lLܲDD$(EM HD$(HH=HRnH5L$HHhH5D$`H=HnH5HIH[H=HHH#H=dHH5HH=AHHD$pLD$pHIxH|$(1LD$pBH$LD$pH$Ht$hH`=HHOH|$(HH2wH|$(LDL$TE L|$(E1E11H$@1LHBH5kHH$HtH=OLHH1H=*HtHL$(H9kH o L$tHL$H$LHHiH H=E1E11E13H5H=H51kH=$$t$ $ $H$D$HH$HwH$DEHH$$T$TL$8NLLHHD$X= $$L3IH 1M%H=RgL袣H H=#gH5 ˪D$T $}$Ht$(Hn$UаE1H=NH5f袐\$XfMJq-HD$h H$E1"$6H|$(H'HA,EE1E1jE1E1E1HD$(GH=LH51H=E11E1HD$(x$D$XD$TD$XLI LH5eHHK"$$D$TE1M$LH脢E1pH=H5m\$XHDwE1,H|$(ǷIH0HH耹HDŽ$E1H=gH|$(I肫LH5dHHM!$uT${1E1fHt$(LHHD$X$u$$H|$(I$D$XD$TtӉD$X~LD$0H$L1H$IHE11E1HD$(HD$(H=311H5[kE1E1x/H=H5/b趞iH5a1CIH|$(IH=LH5bHPH5bH=H5Xb1H|$(IƩH=oLH5KbHD1E1H|$(聵HHDE1H5*1|1E11H=H5h1VH$01H=H5h4GH@~%t!H=@H5h1$tH$0H'H=|'H5h1ɋ1H誦HD$([7H=?H5(j1葋H=*E1"H=1E1E1H5}`1[H=H2`H5,H$H!֕H=H5h1觿H= 衕H=H_H5MH,yGL謶1H2'9HT$xH=9H5j荊H=!H5JfuK豛L脌H$@11HPH$@H`H=`\$XGHH=H5]1L$H={H5eωEH=^H5g1谉H=DH5[_1薉H=/*$|$`"H|$(E1VHD$`H A9DH5HpHtlHt&ǃ@,A<:A@HAt܄HE1>+uHHJRAAPT$xH|$p޻Y^Aj1H|$`-|$T1/L茇T$hH|$(AHHHpL9|H|$(L^ARHLLt$pD$H|$8A[].[H|$(LFE1?H=H5b&H=LH5']1Ӈ HD$pE1qLD$pTH$H=HH5y蜇BD$`H=!LH5\1pH=H\H5Ve1OH=H5]15D$X(H=H5Se1ff.@AWIAVIAUIATIUSHLLLHHÅ~ HLH1H[]A\A]A^A_ff.AWIAVIAUIATIUSH葬LLLHHÅ~ HL蜵H"1H[]A\A]A^A_f.fAWHE1AVE1AUE1ATU1SHhHhdH%(HD$X1D$0HD$8HD$@HD$HD$4 WD$,D$(ID$D$$HD$HD$ HD$@_t'PwHcHfD D$,_u{hÅEKD$E>H|$HL$HHT$@LD6H5H=~1E1E1̄Mf.bHT$4HYWAH=9L1E1H5E1}HuL}LuH|$@4H5!fϝH|$H5H5 f蹝HD$XdH+%(Hh[]A\A]A^A_@ADaHD$ADH=1E1E1LgJfHt$8HYFD$3D$(#$@D$KaIAD+aHD$ aHD$ a1HAHf`HT$0HU<@AmD$H|$E1LHL$HHT$@D A3EtDT$Et$0AExAH|$HL$@IL j>HHmH|$H|$IMRt$4H|$ DCIHD $ExDD$(E<|$t$\H=rH5rc1āD$4Q=a t苍HLHH$.|$4 L $E L $LLwL $Lω$($1ۅH=H5b1!H=DT$0AH|$HL$@IDL O:HH=pE1E1`>H5Lc A*A E1LHjsH|$ (H=$1Lڱ4tvOH=\$'HH %=%AH5maLH1ׂHHu11Ht$PLLH5U1Ht$PL趹H5},L1uE LLtdAthE tcLLAH=H51H5`L1~袿舫H1E1E1t$PHT$HLLcZYwEu-LD$HT$,L1LL $蝉L $AϦEH=#H51u~L $LIL $AWHWE1AVAAUE1ATU1SHcHXdH%(HD$H1D$<HD$@`OD$,D$(ID$D$D$HD$ HD$HD$ X|wHcH#wʼnuf.E1E11E1E1HeH|$KL3LKH5`L觖H5`L蓖H|$@H5`}HD$HdH+%(?HX[]A\A]A^A_`ÅH=YLH51|3D$D$(kZH[ZIADAD+ZHT$<HNa\@D$NfDD$>fDYHD$ )fYHD$Y1HHD$H=1"_2DD$AD$fDD$,D$fDD$AD$vfDD$ffDD$VfDAtEtH=H5E1z{11HT$@H*,t$$H=1LH5Uo(f uV1hH=yIH5JURoMtm5sH=PLH5Nf1'ofH=H5GU1 o1@H$H= H5U1n2f=9H=H5e1nHH=BH5e1n1(AWIAVAUMATIUHSHH(H=\dH%(HD$1H.L=7L诓HHHt6H9t,I$LHEIEn"DH=pM}I<$HEH\$dH+%(-H([]A\A]A^A_H=Ht$ϥIHtwH5BL|HD$H譽IHt%HT$LH-tHt$ḺuPH5RL褆Lm1JDHIH=H5Cd1l1"DL۳tH5RLCfDH=QH5ZdlH5]RL1%DAWAVAUIATIUSHL7dH%(HD$1 HLD8HD=.D;HHHHv"tAH$L9t8É HDJ t&AmHuHDP uMH11 ecgL%,~"@A1LHHd98gH5H1d@H5KH1dLWIHsH5KH1dLHwLHLHwLHYLH#_L[tADžLXHnLIUeH͒LH5 \HH1dHLklLtH5'LuH5JH1cL?lIH{LHhHH5JHH1cLjHfH5yJH1c3f.H56JH1_cLIHt'HH5I1>c=`H5ZH1cLHuLHXLH]LHvmLI dH胑LH5ZHH1bLH!kLrH5lIDH5IHb+@H5JH1gbfH5IH1Obf.LmLHHHĨH5HHAƉ1aDt$EH|$H5HHI1aD$D$DH`HHD$eH5RHHH1aLL$1LHLD;|$}H5=HH1gaAD;|$uH5SH1Ka1H5GH13aɕfAT1UHSH_HIt}t'HqM…!ЉC[1]A\DH=qH5I1`[1]A\ff.AWAVAUATAUHSHdH%(H$1HDŽ$PHDŽ$X)cH5!FH=HD$xHDŽ$`wH$HDŽ$pH$hHHH$1HDŽ$xHDŽ$DŽ$4DŽ$8DŽ$<DŽ$@DŽ$DHDŽ$DŽ$HDŽ$HDŽ$HDŽ$H$HH$`HH$HH}R0XHqcUcIqIMHH5G E1H5G H4uHD$hH5qG HD$HLHD$PfHDH0Ƅ$AH-[sHH$XHD$8HD$0DŽ$HDŽ$DŽ$HDŽ$hHDŽ$HD$XDŽ$DŽ$DŽ$DŽ$DŽ$`DŽ$dDŽ$DŽ$,DŽ$(DŽ$$DŽ$D$DŽ$D$pDŽ$HDŽ$XHDŽ$DŽ$HDŽ$HDŽ$DŽ$HDŽ$PHDŽ$DŽ$HDŽ$HD$`HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$ DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HDŽ$HD$HDŽ$HDŽ$@HDŽ$HDŽ$HDŽ$xHDŽ$HDŽ$pHDŽ$0HDŽ$8HD$ HD$HDŽ$HDŽ$DŽ$HD$@HDŽ$HD$(H$5AEu 27t}P̃vrDGEuqD$H|$(=H|$(Ht8H|$(HdHH5_A^GH= H5S1rZHD$AE1HD$ HD$H=G[H=D H5?sLB^11kH|$ 跪H5`GH|$.H|$ԚH5GH$PH$L H5?GsH$N H5w?.sH|$0P H5a?sH|$8Q H5K?sH$`R H52?rH$hS H5?rL_H$X]H|$(H|$@LrH|$hY H> H|$HZ H> ɨH|$P[ H> 讨H|$`H=訞H|$XH蓞H$dH+%(HĸD[]A\A]A^A_At$t^ P_HcTH= = ~(HcH@=9=H$^Y/iL55$Jf.PYHH5O/HH=1E1H5?AKWHD$8HD$0HD$XHD$`HD$PHD$HHD$hHD$HD$@HD$(HD$ HD$f.DŽ$1u$$ H$H$ HH=H5P1YVfHyH5H=ۺ14VDŽ$3DŽ$@HD$fD3H$fDDŽ$xDŽ$`3H$XNfDH|$@w3H|$@H躌"DDŽ$DŽ$+3H$DŽ$DŽ$ 2 1H}PW2 1H}=_ =]=Ƅ$U2 1HQ}$$5p2H$h#^2H$@L2H$hLE1H5 :H$mH$HDŽ$hHOH59HgkH$h1H|$0LH59I\mMALOH59E1kHD$0b1H|$8LH5`9H$mH$HD$8H%OH5-9HjHD$8B1H$`LH59IlHDŽ$`MyLOH58AgjDŽ$H$`0 1H{$(0 1H{{$,_0 1H[{$?z0H$-H=ƨE1E15HD$HD$ HD$$E1䉄$$E1DŽ$ 0H$`LE1H57H$pkH$HDŽ$`HOH57HiH$`b/ 1H^zDŽ$/H=H51hQDŽ$DŽ$DŽ$`/H54HpjHD$X.H$HD$`DŽ$DŽ$zkDŽ$[DŽ$K.HwS:u.HH$҈$nL$$HLDQ~PHuD.H$.HH$kAL$1D$1L$ D$EL$(MD$IIA9 E9t C|=,AWuH 1I|?xIIcAfDDAd AGE-H$@H5Hn%-H$DŽ$DŽ$,H$,H,H$8Hq!id@,H$xN,H$0H5u&L)ZH$hH9t@H5T&HZ_HH=1E1H5;A[@HD$HD$ H=ݤH5:1/@HH|$ HD$H)H=H5:1?H=xH5;1?SH=^H5v?;HD$AE1HH=/H5(AE1PH=HAE1H=H5uAE17?H=ˣH5-(PH=E1谍HD$AH=H5:E1A>HD$HD$ {=Ҭt =HJ$LOLLdH5'H=c>H=KLD$`H$1L T:$8H|$ KHD$HH=豌rH$PH=H51:=H=而OHn[H|$XH٫h$`ZHD$XFH$H5j;H=#1|=$$$t;1LYtH$XL1u2H=֡ыD$H$XLuGHt-$L5D$L狌$H$H$Nc$ Ht$LRLD$HT$LH$PHt$ 0$H$Ht$uL:$`rHL牜$$sH5LL$L[ 5u $uH5LHH$tL{}j1ɺ,L/QH5LBH$L`MADžL-VHHz$H$Ht\HH5THH111HD$hH|$HHHHj^H;$$7H$zH$H$HW`H|$@-H|$@1PD$D$xH$H$L$9l$xXH|$@AHP9H<D|$pE1H$IHH$SIHHH3Hu HD5ӧLԧHMD|$pGH=H5D$pPSD$p-D$HO/H;L5HlH$X1Ҿ6LH$NH=H5#AJ9H5N6LflH=ʝH5"19H=H5"19H=H5"A8H=}xH$uHlhiH=HH$H5X"H=$1Aw8H= HH56HH=HDHJMHh1MH57D|$p"8|$L$)$)H$<Ld$1DŽ$DŽ$H$Lt$pLl$xLl$PD$Aj$PD$L$H$H$xH$pH$KZY($<H=s1H5`!M7$dK(1$$<'(BI{UH$H'L$$<1L!Vg'H$1Ҿ Lb|H$%<$HDŽ$&L$H11M&yHyxL9>&H#1ɾxHH$HLxH%$%=ja%$`#%$$$$LLH`rHxyCH߉92$,$$@B=H LHcHH=HCḤL1H=0H545]HH=1AH53]5HH53H$H$`H$HrH%P111IIMHI9H>w|A3AAAAA$_DRA HH$H|$@HŢH=.1AH54z4H?ƒ!ЅtH$1Ҿ7H>vHuH=H521A.4H=ǘ‚E1ɺ!HuL9D-t=.6AT3.'A|3--1ɿHHH1HH$2H=0+HL1H=H52l3ErmE1AHPLHHF LHK~ A}"B!11Ҿ HxH]HxEH5L12 LLiADžQHADA Lt$HLL6rLH5bLjAc H$ht>Ho@HtHb@HZ\ H=KHt A\ $11L$ADŽ$DŽ$DŽ$$L$AAD$AH$1HH$HH m' HDŽ$H=7$tK$ $H=wHg$@+ $g DŽ$E HoLDŽ$ Hdlt Ht$HHߺZNH߉Ɖ$I{ H5G$Hc H11Ҿ HrHH56EDŽ$E&L$$1H$H$9Hkt+11ҾJHrH~H=H51 0HyHc}HH`H$y@HH$HcE}H`H$@HH$wHyHc}HHH$x@HH$<Hc|HH$f@HH$!$sH|$h IŅ.$HD$h$LHI3A}-u LL9H$$@ H$H5Q L1 11Ҿ LYf1A}-u3 LL^9H5 LAFHEA11Ҿ L fLJLZf H5 aZ1H=LIH2 LL8H5 L1 11Ҿ LeA}.t3 LL8H5^ LAOADž$H uxH$HtkH$H)H9[14AHA H9|ED1Lt$pLl$xH=H5 L$Ld$H=j1H5L$Lt$pLd$Ll$xH=>H51L$Lt$pLd$Ll$xH= H5d1]H=H5J1CH5L1-NHH$H=1H5,L$Lt$pLd$Ll$x>H=|1H5L$Lt$pLd$Ll$x H=K1H5L$Lt$pLd$Ll$xH=H51Ld$Lt$pLl$x]sHLd$Lt$pLl$x"H=H51,BHLd$Lt$pLl$x"H=H51MLd$Ll$xLLt$p`H"H$H~9H=`H5q1MLd$Ll$xLLt$p`H='H5!1yHt$H LBQ,Ht$HVTN9PHL$Hy Ht$Hʀ<H9L$Lt$pH5tLd$Ll$x@SHp7LIH,H5dL111Ҿ L0_H8c$${H$1DŽ$HHbH߉bHcf@LHDŽ$HDŽ$It1H1J x^Hu11Ҿ Lb^ LLj1ADž1H$H5L!$H5L>HH=|LH5U1J[11Ҿ L]eH$$11L$!=H=|H5111Ҿ Ll]LAL]$9L$Lt$pH5Ld$Ll$xH=6|1A$H=|H51hH=|ejI9Ht$HB H<HD$HHctpL$H5.J11Ҿ L\~L$Lt$pH5DLd$Ll$x@L$Lt$pH5Ld$Ll$xL$Lt$pH5~Ld$Ll$xL$Lt$pH5Ld$Ll$xL$Lt$pH5Ld$Ll$xL$Lt$pH5zLd$Ll$xL$Lt$pH5Ld$Ll$xnPH3LHH(HT$0H1H511Ҿ HY[ LHi. A} eH̃H551Lt$pH='zL$Ll$xLd$p11Ҿ HZHAa?H9[$H$HHH}HLHDH5J1 LLKoHH-AD4H5L+;Hu0 LLKHADHL:HtH5L1Ht$H LSK=HL$HHH5H:H4AEA} 2At&HZH=xIM 1H5A  LH,Aǃ11Ҿ HrYH=HYAFHH51Lt$pH=GxL$Ll$xLd$H$`UM1AH 1LIH& LL+H5L1:11Ҿ LXA}.t7 LL+H5L$Z9HAE$11Ҿ LhXLSdL H5cL EDA}"qHG[$H=1vH511HߺAZSLt$?HLq01Ҿ@LH X&(H?H߾8r1Ҿ9HH )RH5HhSHD$XHHt71ҾHRH50 Lh#H5~LH|H ~!H>.LHS#IFH=$uMH5L$Lt$pLd$Ll$x^LFV$D$11H߾yL$MLt$pLd$Ll$xRH=tH5H1LU럾'LxUL$1L!HDŽ$LHDŽ$AUL1Ҿ#HDŽ$LHDŽ$UALd$Lt$pH5H=t1Ll$xWH$$<7D$YH=sH5CLd$Lt$pLl$x$<6XI$<*t\H=|H51`@Ld$Lt$pH5H=Fs1ALl$x$<h6H=sLd$Lt$pLl$x]D$dHPHr|H=r1AH5 'J1ɺ!L~#Hc$1ɾ|Lb#HJHcT$p1ɾ{L@#H$(1ɾ}L#H<$(H{H5. AH=!r| )$$1ɾ4L"H$$Hz{H5 AH=q1 ޲$,1ɾ~L"H$,H/{H5 AH=q 铲H {H=sqDH5 A kH$H5j H=zH=zH=zH5 1o H$#H5 H5LnPH5H=p1) H=pH5 AkH=pZH$<韱H5I@HHHA1Ðff.fAU11ATIUHH!LH5b#H1 11H LH5e#H1k 11H LH5h#H1F 11H LH5s#H1! 11H LH5v#H1 11H[ LH5y#H1 1H1Ҿ6 LH5#H1 1H1Ҿ LH55H1 1H1ҾLH55H1h 1H1ҾLH55H1C 1H1ҾLH55H1 H11Ҿ+}H11ҾIi]LLHA\H5"1A] ff.fAUATUHSH( 5rxdH%(H$ 1HH=hxH&H0@IHt;H=IxH5651c H=4xLH=%xL՜LYLd$ HL HtH=wLH541 HsH H=wHIH=wHH=w1HH=wHjMHu4H=wLDH541LHT$Ht$HH|$t?H=KwH5m41eHt$H=1wT$;H=!wH5@1;HS?HtHH=vH5}1H11ҾLHIHH=vH5HH3HD1H&@xH=`vH=vH5i1H>vH=_v1H5fy H=Dv1H5\^=x H5`\L-uILJ"jLE1jHcI ILH;.ZYueH=uH5!Ll H503n H=u11Ҿ iLH$ dH+%(H( []A\A]@H=uH511HÚ ~*A,H=Lu1HHf9- H=/uH5N1IB@H=uH5T21+nfDH=tH5!21 fD+W:AWH572IAVAUATUS@HdH%(H$1ƑI?HF#H3H6#Ht4IHt,DtE!@uHBIHuML H51HQ;H$dH+%(J Hĸ[]A\A]A^A_H=sIHtD sEMtLLLH6= 1NDsHE=HLAL*9LLmJHL:=@s5*s~L51L=e?LH(x s H50LwLLuAT$Mt$ L0f.L/H\ ЉO : qHyt \H/ ЉD|DqEH=gH5E1f.H:uLH4H=qH51H:tHa 8>&YfLL6 H5V0LH5 /L~L-H=qH5.1+Lc#ƅ/ Ht$ 1Ht$HHLcALOHt$1ҍ{I ?)I1N t E1q H=pH51H==f8P67fH=QpH5-1kH=o?H5oH=o,HoHHP(H= pH5-1#fDH!8HT1Ҿ9LH oBfH5LACH oLHHD o1BMLH5H1L5boLHL8fHD$HHt$HHfH=dNH=nH5,1H5H_LH1LHLHLH5HHHD1LIHLILH5jHH1Ly HHNH54H1]L@HHH5H19L5IHH5*H1LHY?HLNLOH5",HGDH6t11Ҿ HND~ھLKL0LL#t ?LH5H5H1H5HL5^+H5K+HH5FHlfHylLuH5*HI4AuٺH5HH$19lxH5H11ҾLLx?HH5HHHHD1bH5H1QLYHICD$1LIHLL=*H HHHH5*1;\$taLHHD$H|$HD$HL$LHH1;\$tuH5H ;\$uH5H @LLIH^H5H1E1IA1ۄu4,f.LHA/AGI<:u׺H5)HD)]/iëHH5֨=UUUUHHGE10/fDLH H5(H L4+"H5pH u@@ "@:@.t@/@\H QHA M:D/\u QHIAHQ<:< QH uiPH=F_AI?AD$tH=gL1H|$>LRCH=gH5%1HH=W]LH5`&1#HL~sHcH5>&I<I.tHMtH5+&L1.t0H5&L.tH5cH AH5nH~ uͻHH5&a HL1H5%HF{,ff.AWH5%IAVAUATUS@H較I1H<H%H,HIH@uH@;HH=@fIHDfEMtL2LLH$)1@LHHU3L}+LLmh2E1LfDL1LLE1A.fH=iRH5bAfH<$1H=>RH5H11E1E1ADH=RH5*E1E1AE1H=QH5bAE1{H=QH5 Af111H=QH5FLD$A.LD$ _!LE1E1ATUHSHHHCHtzHHHHPHp LH(L@8xDHCHE1H5H=PHH(1QH{(HCHD[]A\ÐEPAАHuH=PH5AHH1DH=PH5rADAW1AVAUATUHSHH|$sHH}IHH5A1I\$E<$EtRL-fDELAǀu AH5SHDP@IDH}D1H5D{EuH}H5@1HuHtpLHAąuAH=YtNH}H51H5YH|$HD[]A\A]A^A_fDef.H}t E1@AAVAUAATIUHH=BYdH%(HD$1H$HL5nLL H=lXHd"IHH$IcH9LH5H5.LiX$HL$dH+ %(H]A\A]A^H=XH5M ZX9LH=OXH5eLH1cL5LL!t]H=XLL1H5O2DH=MHH5D1 H5>Ly1fWH=WH51H$H=WH51fH=9MH5z15QWuYH=M11Ҿ -H==W11Ҿ -1xHVH=LH5141UDH=LH5\1ff.AWAVIAUATMUDSHHVHt$AL$I$AIH|$LAuD%eVEtE1HD[]A\A]A^A_H=YVH51sHD$AH=;VH0H=,VH5F뤐H=VH51E1(H=UtUDEAwN,HAUpAEE|D9v)H=UEtͺH5fDH=UH=UH5 ff.AVAUIATA UHSHf3HV%~:L5 ULsLHH9HG2HLtAu[1]A\A]A^D[]A\A]A^f.U1H,kHH5,HH5" HH5]}'ff.fAWHAVAUATUSHdH%(HD$1Ht$*H-SHDt$IE1LDHE IHtiH9]uL}LLLj"uHE MtaID$ H5iLH}H5QH5@H{HD$dH+%(uH[]A\A]A^A_HSnff.AUATUSHHRdH%(HD$1HtdILcf.H[ HtG9kuH;LL!uHCH=HH5H$1CHcSH14H=HH511HL$dH+ %(u H[]A\A]fAU(ATIH5UHdH%(HD$1oLHpH(1LJ4E1DmL( HHL }H5EHEwoH}HEHLH$3;EuLHQH=GH5H-pQHE 1HD$dH+%(H1]A\A]DH=GH51H} H5NH} H59 H5H%H=9GH5O1 H5HUfH= GH51[H} H5H} H5s H5bHATH5UH]HHt%111HIH'HL]A\ÐE1ff.AWAVAUIATIUHSHHL5dH%(HD$1LH9uBLHLAąu-H=OHtYLHOAHEfHEAHD$dH+%(4HD[]A\A]A^A_@H=AOH9IHH5L~IH1HHtH$LH'u"H5 LgfLH%tL9H߉o'tH5 LAH]HyNH=DH5s1$H=DH51H54 LoDAWAVAUIATUSH5H|$@dH%(H$1k NIąH=zN%HH\;NMtLnLHH`H0|$1y)IH5MNcLLHUH}MMD=MED5:MAH\$(EHٺ@LHsAƅp1H(H5uH=C1[H=BA,H=MH514HgH H=LH5; 1 @LH3 -H$dH+%(nHD[]A\A]A^A_D BfKIŋ:L11H=LyHkH;LH(1ɾxHHK;HH=AH5/LA#fDHt$(Ht)E LE1蚊H=K11Ҿ u"A5E HM H=KH5 HWt HL$Y\$9PL$L5D ?)HHD$HAŅvDJEtHR!ZLL$@1LL$LH]VHc)Lc|$IL ?)HJ D@a)HH\$H \@LL$2E1|$11LOH,ЈHc)H\@辈L ?)HH!(HL$H#L@HfD$D JE@L聈ËI IuI A$AH5"AH=#AHAHHP(H=sAH51HeÅ[HIHHHbH=AH516H=A11Ҿ H=@H5~1H=@11Ҿ HzDLzH=@11Ҿ UH eW1ҾHQN@H=i@H51CH?Q?>>H=@H5101 >#H=>H51AH=>11Ҿ ;|$H=;4H51=6Z,H=F>H51`H=3H5a1A@H=3H5eA"AH==H51AH==11Ҿ rH=|$GH=_3H5A_11ҾyHH=03H5aH1LAa#AWAVIAUATAUSHdH%(H$11H5bH=HD$8HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HDŽ$D%;H$HDŽ$HDŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$L5q;H;H;;;;H;;;;r;X;{HCIHGH> HE1LDH2̝D$TE1E1HD$pHHHD$xHHDŽ$DŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$D$PHDŽ$ HDŽ$(HD$HDŽ$HDŽ$HD$HD$`D$lD$HD$@HDŽ$hHDŽ$HDŽ$HDŽ$HDŽ$HD$XDŽ$pHDŽ$HDŽ$`DŽ$\DŽ$D$LD$DD$hDŽ$XDŽ$DŽ$DŽ$DŽ$DŽ$THDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$PHDŽ$HHDŽ$@HD$0HD$(HDŽ$8HDŽ$0HDŽ$HDŽ$HD$HD$ fD;sƒS%PDፐG%E_H5H=2.1HD$1AHD$E1E1HD$(HD$0KHD$1E1AHD$E1HD$(HD$HD$0HD$ H=7 H=q711H|$(H52L H|$pH|$0 L L5gH$L H$L H$zH5H${H5H$|H5H$}H5mLL-^L5]6Mt:I>*LI~+LoLMv L.[MuH=H5H63H=H5H=H5H=d6HH|$EH$H5H$H5uH$H|$ HH|$ `H=5 H=5H5 H5H$dH+%(#HD[]A\A]A^A_Av GAEtp"quHcH@=9=GH$X0=1=Li$H|$ϨH|$Ht虣H|$HHT$pH=(*H5y1zD軨薨|$@u1ۅ&H=H5f, H=1E1H5 H=H5o1H=H5E1˔H=oHLTaHL褱QH=8H5a1腔H=LE1^KAHt$L2H5^L螥@ATAHUHHK+t uAuH=HD]A\fAWAAVAUIATAUSHdH%(H$1HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$Hu1H$dH+%(SHD[]A\A]A^A_DLDH8HsdD$@A@E1HD$HH?HCHD$xL-HD$0DŽ$D$D$`D$hHDŽ$HDŽ$HDŽ$HD$8HD$PHD$(HDŽ$HD$XHD$pHD$HDŽ$HDŽ$HD$ HD$kl"|#wIcDL=~/&wHcHD=~uAffHot2$uDD$@cH=H5mТHT$HH=1E1H5SHD$@E11E1HD$HE1HD$HD$8L5~HL\$L=H$L-HuH|$H|$ H|$@1xH|$HnL\$LaLH|$?H|$0)LH$xH|$8H$dH5D$"3D$#+nH$HefDnHD$PfH|$(tAH|$ L|$(H|$LMMDH|$ W H|$ LE1mHD$(mH$nfDsmH$VfD[mH$>fDCmHD$8)f+m1Ha&HD$0D$SH=4E1r@HyAHD$xD$@AlH$fDlHD$yf{lH$H&aNfMtIH|$(xH|$SHt$(H|$tH|$  H|$ L[HD$(kIDqH$H[cnfDA΀A@AA|@AoA_A OA?A/D$5D$$ D$vD$hD$`jHD$XfjH$fDjHD$pfjH$ HF_nfkjH$NfDSjH$ H^&AoaoH$D$@$uLl$L l$ |$"y|$ DL$EH|$811H$=)HD$ AHD$L$ȃ D$8AƀnDŽ$gDŽ$|$QH$ HH7 L$I}HL%fDHITI}HL?HHuHD$@IE1E1HD$HAHD$HD$8H=XL\$NL\$@MH|$(H|$2Ht$(H|$H|$ {MLDd$(H|$ LH|$811H$;HD$(E1rD$8H|$Ht#1H$L1~KLl$P|$"M ؈D$P|D$"` S?HD$H1E1䋔$H|$Xr<IH|$8$=%=1LEHD$H|$ H|$pt4H$H|$pH5nHD$8H$H( $H$w<HD$8H|$$-|$f$'|$S A1Ll$XLl$Hl$`Hl$(H\$hDt$@D|$pLTH|$ HEH HI<IHLD$0$1LH$L -AIHVDD$@H|$HLH$H_ LxLE1Lm9G|$SDt$@Hl$(HD$@Ll$XHl$`H\$hD|$p H|$|$P|$$^LD$8HT$@EH$H$H|$j H=H51H|$H$D蘔H|$(IHtqH5jOH 1Ld$Hl$(ALIHDHA譅HHHZA9|ILd$LILHl$(zLRE1Vf.HD$ HHD$@E11E1HD$HE1E1HD$HD$8fD諞HD$H!蓞HD$ H{HD$H{DD$8EAƀ>DH|$(H|$MH=4H51膅HD$PL HD$H=H51YHD$ HL9MHD$HMDHLD$0H$L1ҋ$L >IH\$P1CH=wH5H1ɄHD$ HD$BH=KH5,*HD$ H=*H51|Ll$HD$HM>H|$(1؜HD$HH|$XH|$1H$LQED$PE1HD$HHHD$ HD$dHD$H=_H5P1A諃E1HD$@HD$HD$8HD$@E1AHD$HD$8Ll$L$@DLH߀H$DEDߢHD$H|$lHD$@H$HtHL$xH|$8H1H5H$HtHL$xH|$8H1H5łH$HtHL$xH|$8H1H5r蝂$==Ht$H|$8DLbE1ۅ3H=H5L\$A9L\$p1H=AE1E1E1HD$@HD$HHD$HD$8*tHD$ Hr~$H|$Xr4IHHD$HE1D$PL$hT$`H$H$LHD$@HH57H$H|$@HH$LHD$HD$@E1ANHD$@E1HD$HHD$E1E1AHD$8萲H$n111L՗HD$kMLl$XHl$`HD$@H\$hAHD$@HL$8HT$HELH|$E1ۅ.H=H5,L\$A4L\$kE11E1AHD$@HD$HD$8=|$vD5Ht$H|$8LuHT$HH=kH541HH5H=J1AE1A@$DH$L1@1AD$@HD$H At8E1!H$DA~H|$HϜH$A9|Dt$@i|$5Ht$H|$8٢E1E1A|$@NABHD$@HD$H=KH5d1A~HD$E1HD$HD$@MHD$@Ll$XAHl$`H\$hMHD$H!H=1E1HD$@,H=H5+1A ~E1HD$@HD$80芲Ht$H|$8DLnHT$pH=dH5A}E1HD$@$H|$Xr0IHHD$H1D$PA3H|$DL]AE1xH55zHD$@E1AUHD$@E1E1AHD$HHD$8)HT$(H=|HD$1H5A|L\$H$Ht$H|$8;Ld$(qHD$@E11AHD$HHD$HD$8f.DHH5 Hff.ATSHHD%HXEt5E1 At&HHA4軺uHD[A\fDAVAUATD%USHHkLkLs8HHEtkE1@nAtTAtKkMLH$rL uH=H55A:{H=[D]A\A]A^fAVAUATD%USHHkLkHHDsEtmE1@AtVAtMELH$rL wH=LH51AzH=1,[D]A\A]A^AVAUATD%WUSL7I^InMI8EtfE1.AtRAtI+1MHHMLi}uH=H5AyH=[D]A\A]A^@AVAUATD%USHHXHhDp8EtoLE1AtTAtK1EHHMLyH=H51AZyH=[D]A\A]A^fAVAUATD%USL7I^MnII8EtfE1AtRAtI1MLHLLYuH=nH5ݷAxH=UP[D]A\A]A^@AVAUATD%wUSHHXLhDp8EtpHE1NAtUAtLK1ELHLLvtH=H5P1AxH=[D]A\A]A^ÐAUATUSHHD%HHHL(Et/E1DAtLHHAuHD[]A\A]ff.fAVAUATD%WUSHHkLsLH@EteE1.AtQAtH+HHLAI|蚡uH=H5HAvH=[D]A\A]A^DAVAUATD%USHHXLhLp@EtoHE1AtTAtKHLLAH|tH=H51AZvH=[D]A\A]A^fATUSHPdH%(HD$HHD%HXEtXE1HAt;At2E11HHLHc4HuAHD$HdH+%(u HPD[]A\>ff.AWAVAUATUSHXD=dH%(HD$HHHD$#HD$0HhHD$/D$+HD$8E Ll$#Ld$L5Gu@HD$HdH+%(wHXD[]A\A]A^A_f.ACM111HAA L1LHHHHߋHZDLvHct$LHHCQuT@D==E@HD$0E1Ll$#HD$Ld$L5b AM111HA>HL$H߾DŽA L1LHAHHHߋHDLHct$LHHLnfAu AWAVAUATUSH(D%dH%(HD$HLhHE$Lt$uLLLHHD$dH+%(_H(D[]A\A]A^A_@A#11HHADLLLHHyDLu]LLHXf.D%MLt$EtE1L|$ Lt$H{fAtoL HI111HA=LLHHDLKuAfDA"Jf.AVAUATUSHD%dH%(HD$HHhLEFLt$HuGfLHLHD$dH+%(GHD[]A\A]A^fDA HHLHDLپtAI111LsAuaLHLC\fDD%uLt$EtE1Lt$HfDAtgYHHLHDL襺tAI111LIsAu-WA6肤fATD%USHHXHEt=E1DAt*HHAH`Hc/muD[]A\ff.fAUATUSHHD%@HXHhEtRE1L-u At:HMHHߋAH DAHc觡uHD[]A\A]ff.@AUATUSHHD%HXHhEtRE1L- At:HhMHHߋAH AHcUuHD[]A\A]ff.@AUATUSHHD% HXHhEtRE1L-U At:HMHHߋAH $AHc臠uHD[]A\A]ff.@ATD%USHHXEtTE1H-DAt:HPIHHߋqAH AHc菨=uD[]A\ff.fATD%USHHXEtTE1H-ODAt:HIHHߋAH AHcuD[]A\ff.fATD%USHHXEtTE1H-DAt:HPIHHߋqAH AHc菧=uD[]A\ff.fAUATUSHHD%HXEt\E1H-L-b At@HMHHߋH :LAHcjUSZYuHD[]A\A]fATD%USHHXEtTE1H-_DAt:H@IHHߋaAH AHc-uD[]A\ff.fATD% USHHXEtGE1H-DAt-HHAHHc4H uD[]A\f.ATUSH dH%(HD$HD%HXEtYE1HfAtdH=ҲD$UD$ HD$@H\$0H$H<$1HE1E1HD$LH8tjHx1HLlH|$0`HD$HHt$,J|(!Hc|$,7ID$, ?)ѺHJ T@A9DLII9xA1H4$E111A|$lE-Dl$E1SxH=G11ɾ )Dp'o5A1XtkL1H-MI@H@H$9ILAHHxHHcH*HuLMIŋ5OA$.1$~n5е$$;D$H$H$D$`E$?|$xx%ft$8?L$L,$1H$&H (}H5`H=ѡHHEDDH1=H=11Ҿ 节DѽmL$x$5&@1t[1L%f.H>I}MHHTAHHHcFTu5?$1$l55$$S ;D$$dL$H$&ٳ1HH {H5H=]DH(HED1;H=;11Ҿ Ddl5>1D-KEtpE1HHLIDHE=H$ )IHHAHxHcH$HEuLIHŋ5<>"1$rk5IJD$;D$$<DT$xEt'HH=H5_1h:DŽ$<KDL$8EH1DHH zH5OH=EDH:HED1:H=11Ҿ Dƺ}j5'=1D-EtrE1HHLIH%H$ IHHKAHxHcH$HeCuLIHŋ5<1$i5$D$ F;D$D$@E$|$xt'H H=vH518DŽ$@t$8#L$L,$1sH uxH5H=H=HEDDH1\8H=11Ҿ }DhL$x 5s;1\tR1L%9Ht7I}MHHAHHHcjKu5 ;1$@h5$ wn;D$$HL$C1H+wD-HDH5RH=ÛEDHUHE1 7H=11Ҿ |D̷g5-:1-tP1L- Ht;H$MLAHHxHZHcH6_du591$f5N$q3*;D$$Lsl$xt'HRH=H515DŽ$Lح\$8.L$$1HuDHDH5~H=HEDHHE15H=(11Ҿ {DQf581-9tW1L-xfDHt=HI|$AMH$HHHcXu5D8*1$ze5̬$;D$D$E1HktD [H<DH5}H=EDHHE1J4H=11Ҿ yD d5m71VH$|$xH55L7A/1$d5ѫD$;D$(D$hEsH|$H0DD$Et:@H\$Hy}=HHӊ9H ǿ%HL$HtL$(HHD$0H $HD$@D$Ll$LH1HL$(óH rH5{H=nH-HHEDDH,12H=>11Ҿ xDgcH\$(H\$o_HHH.D5qE1ILEA11`5.H;1.uH;v8H5CtA%H;HHHpHH11H;E1A57.HHIc\ HsH蝁I9@541H$Ht$|$x541fH~bLt$I>IoM9u5PfHnʼnڿw90;D$ED$H$HL$@L`LlLH;$o.HI9uLd$l$ 1EШLl$(L,$D0ELvLd$Ll$(EI<$$oow.IM9uH DH$1H-_UHL$H?$tI܋"IL$1MD$8It$MĀW30IL;d$0uL$ H5pH=T1|$xHH5;LcL=yH5oH=+D$LHyHDl/fD$TA*HL$HH^ IIMIu1MŀEE8s/ IL;l$0uċL$ TH5oH=1|$xHH5LcL=H5nH=CD$LHRxHD.fD$lA*HL$H^LIDB;)H$$HT$HH1H|#yHcHD$(cQAfD  1HtVD$$H$H^ |  1H=VD$ A\ H$HvH$H=H5w8-H$H=͑1AH5w\-H={H$HD$PH<$8 H5ogFH|$PH$xdH+%( HĈD[]A\A]A^A_ 1 H]UD$xHA]:H$H=H5m1d,'C H$Hb$@H$H=@1H5l,f.H=)E1qH H$bHD$H~DŽ$h..}  1HDTD$Pf HD$0zAD$DŽhHH$0QHDŽ$$H$l/AD$DŽ0HDŽ$HH$0H$8H$@H5jL%I4$L|`IHI9uܹH=zkL H=`kLH=KkLL%= I4$L_IHI9uLH=kL%ǥH5iu  fI4$L_ IHI9uܹH=jL Ht$8La_ Ht$@LL_ H$H= L1H5mjAR)4D3H:HDHeH$H=H5sH1A)AD$DŽ$D\$EAH|$'H|$_/@pDT$xEBD$8'HDŽ$dH$\H|$n2H=H5iH1N(Dt$(+H=݌DH5tA((H$HHD$hH=L-@jvH$HL$@Dt$Ld$hHHHHI@H LL@=AH  L)AfI>IkM9uHxL\H\H\@I>I4)L9uI>IRI9uI>IHI eI~eI~+ L@I~, Lo@I9DD$xDt$Et+H$Hl$pf.H;H7H9uDT$8EeAD$DŽPHeHD$HD$H9D$hDt$0H|$P"A,HD$PD$|H$HHD$hH$$HD$H$HD$=D|$E1L-|@II|HD$HDBt-KTHH5iD1/zH[1H-H\$.H5!ftP/\SD9sMHDf/D$!wH5eHeHDH5g^Pz[/럿 1H5Ph17/4HDŽ$XH$PH=YH5pHD$PA$H$HHD$huHٞDt$0L$pHD$ H@HD$HTHD$(HhHD$H$HD$HL$PH5\@LA L냼$,>IH@H#-H ~H=xH5aHH1D%2JDHH|HH8HgE1L4$LLbHKLC8$HsrLLH*MHH;\$0rD SL%|gH5%SH=wLqH VEAHJ\AHD14H=w11Ҿ XC5X1A|$xLH53ޭ58Hc1D$nCHDH5RD$H=JwA EH[HDH ьf*^D$HHMIL$It$$rMLHED$8)+IL;d$0u=L%(fAH5QAH [LH=vH HD1H=zv11Ҿ \W[B51|$xLH5苬5HcIH$载1D$BbDCH5dQD$H$A EHZH=uHD+H nfA*^D$HHDBH@|Ld$Ll$(EȈ)H01HH׉LA_H$$HD$H}L$$1L=HD$(H-PbZXQPtMHHA|4IݘIݘIL;l$0uLHH;\$01HØ̇HØ,HKHs1LC8LØ!4uH=6tH5w`1H=t^iZ1Dt$KB/tH$L$HDŽ$HDŽ$]AH 1HA|UHH H*~ H$H? H$Hz?u H$1IHZ HOKJ H$L702 H$1LHHD$(, H$HH=H$1IHHJH$L/1LL,HHT$(L+{H LL+aH$H9$KH HnZ XH$H$LHH(HNH$NHo8Lg8H9\$0L$ H5NH=HAT ֭1迬H$|$xH5Д軧Hc螬H5VHH=GqD$(H=vAL HLHE| fD$(d*HH^ @B7Dt$)HT$`HH1HDt$H Dt$(1L4$H$H$L-HL$L=ZLƃHDŽ$tLL$-1HqHsH@1A|QHHH'LH<Hs611L$1HH$KHH9\$0ILʂHKAHsHkHITHS@HS@&5HH9\$0uL$ H=UHkLP H0]1F|$xLH5ؒCHc&8HTH5J$H=nHkL=H HDLHڸ f$*H$HH^ LHMHU@AHuHWHH9l$0uHkL$ H='xLP H0b1K|$xLH5}HLc+=H5SL$H=mHkL=H IEL f$A*H$H^LH=ÀHL$1GHH Hv)G@pH= mH52L1^H=lV?L$ H5;IH= HAT 1|$xLH5ҎHcH5.HHH=lD$H=AL HQHDfD$*HL$(HH^ MIMIu1MŘEE86[IL;l$0uHL$ H5EHH=uAT %1|$xH5L HcIH$~H5QH$H=kD$H=AL HEfD$~A*HL$(H^LH)=~HL$X1Gs~HH Hv)G@0~H=jH5T1H=jT~DŽPaFH=jH5I1H={jvTH=jjH5V1H=PjKT}H=9jH5T1H=$jTq}DŽH0eH5}TH=i1GH=iSH5=HH5HHDŽ$c7H5H9M7H1KIHH E1ɹL|HEDOt}LLtnH$1qH$HQELHDŽ$/HrH5'GH=hH5R13H=hRH5FH=hH5R1H=hRHH %=H=AhH52FH=.h)R_ H5EH=|rH=nH@Cp >{HZ1-HZDH5NLH=gDHZHE1H=g11Ҿ HDɃ35*1H$|$xH5话5 A1D$?3D$5zD趜xzoz;D$0BH|$ 4HHD$H`WH9ZH,WD$HYAD|$H5J01D$H25HKAD$HH=gfH DH5!AHDHD$ff*^D$HHL$(*HHHD$YAHL$(H9D$X=<Ld$`Dt$|H #eH={C1GH-AA H=dH1H9\$H5d 1H-ALD$1H=dHCDHH=dHظH9\$H5fd TH|$ H5BH|$0H5BL=0:H=zM1FH cH=nBH-@FA H=cH1Hq9\$H5c 1HL$1H=cH*B9T\$H~H=ucf/D$HA^TH9\$H=cH5aM1ADH=cM*wH=cH5_M1H=cMvDŽ$H=cH5L1H=ucpMv^Hh?/f HsHD$aXH=YqdH|$PXE1E1H59L1> H|$XYH5!L( LPHHH<$菈H$dH+%( HĨD[]A\A]A^A_KHD$;1HqH$HD$ IsHD$ aHD$(QE1E11H=SDH5WJ1H|$PXH53K:H|$XYH5K$EVL$8( HD$0L8HHD$0H= SH5vG1_HKH5KL9&IHK H5KLL;kH=RHH5RG1H!"HL%H|HD$Hl$H=RH5HG1HH1HHsADt$Ll$8iE D$ HD$@D$HDt$LLl$8Ll$0 D$AD$HE1Dd$}DH=QLH5IJ10ULH0Aą%DH5A MREM}IM&Mu |$HlULHAąx|$HuA-AbAuE;HEDHxWH=QLH5II1LI$D$ROAAuEH=PLH5VF1D$ DA AuHD$@HD$hHD$pLL$XHDŽ$HL@HHHT$pHt$hHLS0IXZMi H5GLH5GH=nHD$xL纼H5GHD$`H|$xH$HSHJH|$`>H|$h2H|$p&HD$ Ht%H5SGH7H$H H5H8vHL$`I1HIHH0uID$0H}LQ$D$EHEDHxCH=NLH5zGI18I$D$V;HEDHxIHTIs IHL\$+L\$LL$PIK E1L\$HISLIsSAZA[HL\$H=oKLLl$8H5AD$;AH=9KH5C1E1fDDHAHEHx-A9|lH=JH5C1Ll$8;HEH=JH5HP 1LhH5BH|$xH5mBtH$H5TB[H$H5;BBH|$`H5%B,H|$hH5BH|$pH5APH=JLH5B1L\$^L\$aH=IH5=1?H=I1H5A%ET$H=I1H5>dHD$@H=IH5A1JE11H|$HH5y.H|$HH5I HEDHx\HD$@H=HH5A1MH=HLH5>10D$=H=HLH5-<1qH|$(Hg`H=HH5A14Ll$8H=^HIH1H5 LIH1AHEDL\$HxdLL$PL\$HXL@HHRHEDHx4HD$@H}H@D5H?H5?LIHH5?LL_AH=vGLH5|=1L\$L\$H=OGH5i@1Lt$HH5LZtPH=GH5U@1qHH5Lt!H=FH5C@1B1L$=D1H=FLH5<1Ll$8D$H=FH >H>1H5LOeLl$8H|$xH=OFLH5<1Ll$8D$HT$(H=#FH5 ;w}AE11mDATAIUHSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$DHHD$HD$ H HD$H5?1$D$0HLH1,HL$dH+ %(u H[]A\ff.AWAVAUATIUSH8 $1D$DD$E1Ht$ HT$(LL$fHHŋ$?D$cE1E1DH#IHtPH'ÉItH5pD1DDH>dH dCHcHHH+$IH=D-A\@LHD$LHD$FLL$DDLD$H5CH1H >HtH5CHD1H$oLA fDH=aCH5Z?1AH=HCH5?1H=3C.-H$DD1H="H zH8D[]A\A]A^A_Ët$pL$xYLAH$HlLD DT$pEDL$xE LA0HE1E1jH$H11`-_LAX\$p,D\$xELA* H$H$LuDT$pD$xqLATH$HL\/H=A1AAH5 <L!@H=AAx+q4$HH=VAAK+4fDt$HHt$HtDLA$HAF$Pj$P$PLL$HDD$4L$0HT$XHt$PH0LA@H$H=@H5J<ApfL(H$11HtLH$HWLH$H`LH$11HH=?LH5:1A2H=?)AWH'E1AVE1AUE1ATE1U1SH>HdH%(HD$x1HD$P5H$HD$HD$XHD$@D$HD$HD$ HD$(D$8D$4D$<ôtOPwHcHfDT$ DD$}ufkDHD$H5  _H<$2IHsH|$ 11HT$PLL$@LL$@HD$PH|$(wLL$ HD$`HD$HHHD$h蜌LL$ HILL$(HD$ ,cHT$`t$ALT$(HARLT$0jL$PQL$\QL$\QHD$xLL$XL$@H8LL$HH0LT$ LL$HHT$H==H5`;1fHT$H5H=]=1E1E1Һ7H5?8LLT$LL$ 8H5!8LLH<$(L(LL$LLT$LVH|$P>H57H|$&qHD$xdH+%(HĈ[]A\A]A^A_fDD$4sӵHD$ af軵HD$(I諵1HnHD$/H=1E1E1D$8苺Ht$XH.eM*H56HIHt%MHD$`Ht$`H$IHvHD$`HD$@L@M^蚴1H`IHf.MZH{IHuHT$H57{uQH<$HR{H$HD$<sE1HT$H55HT$H=f:H581H=L:LL$H5NLL$E1D$MDM;LL?IHH=9LL$#LL$E1L8IHVf.HT$@H|$XL>IH,HT$H=9H56E1E1HT$H5t6HT$H54HT$H56HT$H55HT$H53HT$H5O6HT$H5^6HT$H55|HT$H53kHT$H56Zfff.fAVIAUIATUHSHHH dH%(H$1AHHHtqDH57Ld$_LHIuyHcLHtfLH> I61HmtALA7@E1H$dH+%(H D[]A\A]A^E1HHHt$+ IHHtIcH;D$u1fH56?ID1H=L7H59E1c3AUIATUHdH%(H$1IIHH5LHHHLHO 1L}IHLE1L 1LIHttHL H$dH+%(uHL]A\A]@SH=<6L1H58E1L+u DE11LE1|H=5LH58E1?AUIATUHHIHtmH5ϴLfHHt6LH3~'H5}H@~HL]A\A]H=a5LH581fDHH>8HgL]A\A]ff.AWAVIAUATAUSHL- 5dH%(H$1HDŽ$HDŽ$HH.LDE1AHЀH;TD$\D$8ID$D$XDŽ$DŽ$HD$PHDŽ$HDŽ$HD$xHD$(HD$0HD$HD$HHD$ HD$HD$pHD$hHD$`HD$@{tw|PwHcH@=)=~ʉMuE1/wHìt׃D$uAÅu{AM11H$LH=3H52Yl@Au*Af[H$HE1H=2LH5e1HxLH$AH5 2WH$dH+%(XH[]A\A]A^A_@蓫Ik胫HD$hYfkHD$pAH=9~H2%ݰH&%L%nHt'f.H=1L1H+HHu1E1fHD$`HD$@۪HD$P˪H$fD質H$fD蛪HD$xq苪Ic{HD$(QD$XCD$\3KHD$0!D$8+HD$DŽ$DŽ$HD$HHD$ ۩HD$L9IHH=f0LH51LH11HHH5;HHH$H$vL^VL9-0tLŏAAyH|$AH|$(H|$H|$ L$H|$H5NHEHD$H*HD$0H T$8H|$01HD$H HD$HD$H D$  HD$(HG H5HHD$H 1HIHo 1HIH 1LgH5HIH|$Pt;#LHHH? HT$PE1 H|$@t;LHHH HT$@E1 HD$HHt HLLLJH HD$`HtHLH4H H|$1L D$8Z Ht$LA1H5-:E7H=\5H|$0H|$YH|$'L\$H|$t H|$ mH|$H'r{HD$Ht H|$1HD$(IMD\$XEH|$0wL{IHtLHD$H=,H|$H|$(LL\$H=Z,UZDT$EHD$HIH|$(kH4H|$H5HD$HDDD$8H|$1EFIH HBIH IHF HHt!1HtHL_mLwLE1DLE19HQH=Z+UH|$111LL\$z% fH=*H|$ L$HD$(+HDŽ$MIH HxIH HD$HL* HHD$HH1HHD$HXHHLHt$ H|$(LH$i…xH$L`LLMH|$HH31?HH"HL$H$HHD$81HL$8D$ <IHHxH5(L$  H5())APHt$8IcHIGHcD$ HLL}$LLvH|$,H$H56(HLH|$t H|$(HD$H D$(H|$ f[HD$HHD$H|$0wvD$IHjLHD$NDL$8E H$H|$(H5H$HD$wIHHt$pL> IHIHHHLLHT$hLLH$LLLH$LLL~HL$HT$xMLLH^HHL BLLL,HT$HLLLLLLULLLOLLLiLLL#LLLMLLLGLLLQwLLIH`L LRH=%H5[&1-t$XH|$0w=tIH@|$\XL.LH#D$H5v%1E1 HD$HD$H=%H=2%-H|$0wsIH|$\tPLi LHD$|IHD$E1[E1E1PLHD$4E11E1XLE1LH=n$H5$1D$Ht$LALHD$E1}LLL\11H$HD$E1E1LH|$@LH5#1E1bcH|$r)rHD$(HHD$(E1E1HD$IHlH|$HH5HD$HHL:IHHD$RE1DHD$E11E1LE17H="H5"12H=" H=YIHE11E1E1HD$1E1E11HD$E11{E1HT$PH=Y"H5"譽LE1r8H=6"H5)1舽1E11E1E1HT$@H="H5I"W1LLL5 FHH\D$ bH=!H5!1E11E1HT$HH=!1E1H5-!Լ}1H|$HD$nE1fH|$ H$H$LHIHt E1JJH=!H5!1Y@AVAUAHATIUSjLEtCuAuLe<t[D]A\A]A^[D]A\A]A^HHt9DHI`H=i L1HH=U H5h1觻HcLILJMAHH'HphH= HDH5'1 U!=H)HcHLdA[]DA\A]A^fAWIHRAVIAUATIULSLHH $DL$ oHHxIH1LLHLL!H$Ht HLHt HLL蝺LMt}H59'1LH=E1H HD[]A\A]A^A_fMHqLDH5n&1LLf.Hqw@LÅ~MHqqLDH5P%1LD$ ~LA0HL MHqLDH5&1LMLH5&1LE1LLI H=$$^@ L9}gLŷڿH5r$I1 ALI=H=~1LH;$}H5C$1H5)L@HpH5*%1LfAWAVAUIATAUSHXdH%(HD$H1HD$0HD$8HD$@茼HHpLHfnDE1+E1E1D$HD$ H&D$$HD$HD$ۑ; ^| wHcHK1Ht$8LS#HǺxA$f=~#=x7if/QHהiD$5DA%D蛔HD$苔HD${1HMIHDAE1E1H=l1L5"ÙH=H5!1.;@߃IHLIH=LLH1l9H=H5!11L%!ʵ.߃HH=GLH1蚵9E1E1,fHT$ H5H= 1fAE1HջLH-H|$0HiH|$8H\H|$@H5xKLNHD$HdH+%(HXD[]A\A]A^A_DAMDD$;賒1Ht$@L HǺXv5胒1Ht$0L HǺvSH;EfDA萗iH|$8HD$(tHD$H D$ $Ht$DH|$IIHH5HT$苾D$LD$@HL$8HT$0L\$(C1H,$Dd$DAIDMHfLD$@HL$8HT$0I6ALSDEIL9uH,$DDd$HʹLH-H|$0H^H|$8HQH5rH|$@@LLDDL_HL/1ELgHA6L~H-_H|$0HH|$8HH5ޟH|$@LtK\AHT$ H5Pf.@AWHG5E1AVE1AUE1ATE1UH-"S1H(qD$HD$D$D$ D$7t{ wHcDHH=jH5!1輱@HT$H=L1AH5蘱H(D[]A\A]A^A_fDAu@賔uD$ t51H=H H5 H1nESE3EL$yT$VD$3E>H5m 1E1H5g 1 SfDD$AAAD$AD$ D$oD$ ZfDADA4D$"fDD$ fDD$fDAH=2E11"H HH̷pH51褹H5AH1艹DH5&H1nH5 H1SnH5H18 莻OH'8H&H{fAUAATUHSHHtt*H=H5,1E1RHD[]A\A]@HA赳HH=11H@IcrHHgH=IDH51HD[]A\A]ff.AWAVAUATIUSH8dH%(H$(1HDŽ$HDŽ$DŽ$tDŽ$xDŽ$|DŽ$DŽ$HDŽ$IH#HH5E1L1H hH*o~D$dDŽ$IDŽ$HD$(HDŽ$@D$hDŽ$D$lD$pD$tD$xDŽ$DŽ$DŽ$DŽ$8DŽ$DŽ$4DŽ$(D$\DŽ$DŽ$DŽ$0DŽ$DŽ$DŽ$DŽ$$DŽ$DŽ$D$|DŽ$D$XDŽ$ DŽ$DŽ$DŽ$DŽ$D$`DŽ$HDŽ$HDŽ$HDŽ$HD$8HD$0HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$HH$HDŽ$HDŽ$HD$ HD$HD$HD$f. tw>|?wHcH@=!=~ʉ(uD$X-f=uAD$HH$蛄u苍dH|$011H$f[oL^H$H LD$($11L !HeH$HU HD$HE111HD$PE1HD$@HD$8HD$0D$X~@HH=L1H5G!eH= LH51MD$XHD$HE1HD$PHD$@H$HD$811E1HD$0H记HLH|$PTLH|$@zH|$0H|$8H<$H|$ {H|$HH|$'H-H|$HH|$HLH|$(dAH$H5]!H$(dH+%( #D$XH8[]A\A]A^A_fDHD$(E111HD$HE1HD$PHD$@HD$ HD$HD$H$HD$8HD$0HD$D$XDŽ$D$X[H$tHzf+H$xHy^fH|$ LH|$ H2*DH=aTD$X諄H$|HVy4f{H$H&yfKH$Hx~fD$d 1HD$`GHD$01ۃH#˃H$fD賃HD$8f蛃H$fD胃H$AG$A[H$AG$A;H$~fD#H$ffDH|$k1HŪHD$H7fۂH$"f˂1HIHH|$ H|$LD$\胂1HIHH|$ H|$LD$\;D$\HD$HyfH$H4SfDH43fDAG$ADAG$ADAG$ADAD|$xfAGD$|AAG$ADAG$ADAG$A}DAG$AeDAG$AMDAG$A5DAGD$tA AGD$pAAG$ ADAGAD$lD|$hfAG$ADAGD$lAAGD$hAHDŽ$?H$HozH$DŽ$H$@WH$>fDH$&fDH$fDAG$ADD$\AG$(ADAG$4ADAG$ADAG$0ADDŽ$pAG$$A]DAG$AEDAG$A-DDŽ$8H$HvIfD~1H7HD$(|$`D$dH$uh$t]$tt@H=H51E15D$XHD$HHD$PHD$@H$H$HHLTHHtyH$ L$11E11ALFHL 1LHH$ƪuiH=+H$H5TwH= D$XHD$HHD$PHD$@E11E1HD$8HD$0#D$X$ $$|H|$8r#RIHT 111HYLHHD$PH H|$PIHKH|$PHM H=.H5 1z'H|$PIXH=LH5sH1IH H|$Ht$H% H\$PHLHE~ HLHc L$`11LfK H$HHL$Q $tH$HHRHD$@He$H$wPHHD$| $u D$EuHcH5sH=t!HD$HHtHLD$(E[ D$4E= E1H|$tGLH\$0IH\$DIH߃襛LHHR9|H\$0LME1H|$tGLH\$0IH\$DIH߃SLH舢H9|H\$0LMD$8E EH$HD$HHD$8HD$0D$4L$(9l$tO9l$xo9l$|9$q9$9$9$9$M9$9$@9$d 9$9$+ 9$ 9$5 9l$l 9l$h 9$ 9$D$EH=1H5ҚH|$0YLL$FLH|$duL$`11LcHt$0LF$H$t\L$L1E1E1LLL蹳L$LLvLLLH$0MHt$0LLx59$4[ 9l$p"LILH5HHq,H=8H5茙D$X: HD$HHD$HE111HD$PHD$@H$HD$8HD$0D$X諱HD$HT$|H|$8H&8MIHHD$P$1LL\CHD$ H;H=94D$XB!LILH5mHH2+}H5H1LL4HHyH50EH1(CL 1HqIHH1L膻IHLLHLOH5DH9$ZLIE1)fDDLAiH5NHH1eL A9|LkH=H5 169$ 9$ 9$$9$LHH$`$lH$H5IHH蹱HcHE1LL0H@,t@uHpH9AHHL)H9}EkIcH5YHsIHL?HcHx?1LL8H@,t@uHxH9tHcI @HHL)H9}EL$PKE1H$8H$X1ML$HAʼn$hAD9$lH$`D{HH@H8HHtHƹH=LtMHLt0IL9$XtI4$HuMu裭IHuMH$8L$H$hL$P @1L6HHH5KH1蹔L輺HH5H1蘔HD$HHD$PHD$@E11HD$8HD$0VLHD$@LIL{LߨnHH5gHH$H螞HgH$H=sH5 1œH=^YHD$HZH=DH$E1L$(,D$XyHD$H1E1HD$@HD$8HD$0KHD$HHD$8HD$0$L$H$LHH$4>$ $D$X$_ =/ D$\LH߅ E1H=HH5 蜒H=50D$X}LKIH H5qhH1^LFLC 5tc H5GhH1+H5"?H15LIHm HH覼L$LHHLoH=bLH5H1讑DH=BH5e1蔑*LL$ILH5 HH2$mLI蒖LHH5 H $HH5莢1LDH5 &LIH$LHhLH5 H߉%LL$ԙLH9LHH5 %LLL$HLH5 %H5 LH$L$(*H$L1记H$AY HD$HHD$PHD$@HD$81E1HD$0D$XH5F1HD$HmH=uLH5;H1WH5H LL1LH$@H$H$HϧH5a H1FD$XE10HH5S臠LHHėH5 <He D$XH5[H1E1jDH5aH1̎DL輕H `LHAH5(1螎AEH5&H1zAD9DPHI赨LA*1DLI:H 2;LH߉$8H51D$8At8E!H5H1DH5lH1׍XH5qH1H5[H1諍,HD$HE1HD$8HD$0D$XuHH5̞L褽@H=H51JHD$H臠xH=1H5H$ LD$(H$L 1ҋ$H$FIHH=qH5 1ÌH$LL@LIHD$HM$K DŽ$H=H51cH$Ht3LD$($x1HH$L QEHD$8HH$H|$@H$HٽHHt$8HIH$H$(1LHHD$IHSLL@L<|$XuL譋Ht$8H|$@&H|$@LHLLF|$df$GH$t`LL$蕽Ht$@1E1E1LL}H$L=H$LLH$HL$ H$HLHt$8L0H|$L L$MeL$H$LLL衕 LE1A:8qH53HH1 $AW H5H9CT=AE1Iԉ$D9H5H1貉$D$XdH=;H5 1E1芉D$XwLHRLD$(H$L P1ҋ$H$cBHD$0HoD$XH$E1L$(HD$H2H$11HH$HHDŽ$L赪H$1H蓡H$HsyIHtm1H%t,LLxtLJLH,wLt$1E1HD$HHD$@HD$8HD$0HD$H1HD$@HD$8HD$0HD$H$H1E1H5E1чLLH55H5L!E1E1H$L$(H5;]H=1oH=D$XPH$L$(H53]E1dH5H1E1!E1E1EMH$8L$HL$hL$P*E11L1HL$`11LOLMH$L$(:H=3.H|$LE1D$XHD$[H$HDŽ$HDŽ$8L$$01Lq#IHt*HH$L1L/H$8H5VLL$M LH$ML$(BH=;6L$.L輧IHhM)A}H5mH$LIHML$8AE.srlAEŹD$XH$E1L$(D$XH$L$(1L.LH|$P裭H=W1H5>H$L$(E1薄L.D$XE1sH=IH5`1H$L$(Q1H=H52>H=H5TE1H$L$(D$XIH=H5H$ML$(ǃL_ H$H5 H裃H=7H$E1L$(D$XlH= 1H5H$L$(E1JD$X7H Lt$H1HHLcLHDŽ$(H$ IUH\SHκHtyHHHwxH=t6H[]fHIHH51H;蕂H;-H=uuHH5 ϙHXH[]ÐH[]DH=9Ht4St1H="DH5衛[H@HH51H;H;fDAUATStSu8H=XH5M3_YH57HHAD[A\A]@k_AIu)LtDHLxsCLct<:tLCHt<:tfHL辄yHL1E1H5mH;H;NL-tLH5G1I}迀I}E1S`f.@H8VUHH=@Ht H]D]fATIHUHH軙tLHtHv*H=C~Ht.HHL]A\f.LؑHHtƀ8tH]A\ff.ATIHUHH+tL菑HtHrv*H=~Ht9HHL]A\f.LHHHtƀ:tHLpH]A\UHH=UHt H]D]fH?0uH?0tHv>0ufDH>0t骴f.H(H?0uH?0tfG<vP H5SH=BHs@rtO@wt)1@atÁHCHHDHHaHDHHBHDAWAVAUIHATIUS1HbD$ HH9H|LpA<-<+D$ II4$Ht}MIwIHtcL諈uIGHI#E|$ IEtaI GIEH9vH5jHWD$ H[]A\A]A^A_@D$ fDD$ I\fIWHH!IEATL%wH1UHH5SI<$|HtHI<$H5)1"@H{I<$HrH*9|[]A\ÐI<$[H5G]A\鼍ff.AWAVI1AUMATMUSHH(HL$dH%(H$1HH1H5(HgtSH5(E1LLHKAH H$dH+%(H(D[]A\A]A^A_@11HADžuHLL$1HL$LL$LLL$=HDLHLL$謫LL$AL΅=HLH5H81{1fH9 p@HLH5wE1H81zDHaLH5wH81zCAVAUIATIUSHH@HL$0HT$(dH%(HD$81Ht$ LD$HD$ HD$(HD$0臠D$uGH|$ }HHHL$(HE1d藿HL-!DL-H5E11I}4H|$ qH5>H|$0rH5t(H|$(sH5^H蚯LRHHI}LH5j1]yI}HD$8dH+%(H@[]A\A]A^L-E11KH[IHHT$0H5H[HT$ H5LHfDHL譾tH|$ qH5^D$ H|$0rH5DH|$(sH5.HjL"D$ L-fLL~tH|$ qH5D$ 膑H|$0rH5pH|$(sH5ZHL蚋D$ iL-VfDHh2?ff.@f.HH u`SDHt,t H[D3H[DH|$趤H|$A1E~ĸu@Ht 6fD{ff.=tHf.H7H{H=HX}H5aHHH=H5zH=H5H=H5 1HfH=qHtHHXHHAAVAUIATUH1HdH%(HD$1H$PHHHIϲ~+HD$dH+%(HL]A\A]A^L4$M~OFH-+LH5H1H}suH}MtLLH51YuLE1|@FH-H5UH1H}'uH}MuH5s1u詩fAU1H^ATUHSHլHHHI1 IHu3LsHpHxHH蛘Aąt$L99|AHD[]A\A]ÐHKHH5HSH81PtHD[]A\A]f~AH[D]A\A]HLH5_E1H81t~ff.fATHcUISHH5Ht[]A\EH-\IDHH5<1H}sH}8n}ff.AWAVAUIATUSHHG[HE1+@t3H|$L%H|$IIDh t.kH@uJH[]A\A]A^A_DAED9 AwJ't["tVAuH+@IfD@@HkHDB tI}Mc}kfHCAuHS8uPH8tuhHXI}Mc}"`LAEHH4貝HHtAIEMc}"DLcH5hMc}IEHH1[]A\A]A^A_AWAVAAUATIUSHHH=I1M1HtHSH5LIHE11ɺLHLrDMLLALDL$ Åx EE1y{E111ҾL脄t`L舑ÅxLLHLԋLD$ (\H5sL$D$ H[]A\A]A^A_ÐLHKHLYttu#HH5H81WpHL\1DH5UBHLLATDL$HAI;XZfHH51H;oH;耾HL1 fDHaH5FH81oLH1[]A\A]A^A_HtHt1DHtCSHH[t'HHtu HH[fD1[@1DHHH=*tHff.fUHH5 SHHHzuH[]H5lHyuH[]H5IHyA1EuH[]DAWAVAUATUSHHT$ …uHHuH[]A\A]A^A_ÐHE1IL躴A9DLlHH$~HHHVAǃtG|$ tUDHDHILHHAǃuH4$HVntLAA9]H5YZL$v$H[]A\A]A^A_@AUIATIUHHtx~L%H=tx1Mt)LHLHH5]A\A]?~L1~HHI ~HH5~]L纠A\H5fA]H5H}vAUATIUHpLILHH5AHH57H}HL[]A\A]L(HHH5m1H; gH;襵Ht fDff.@Hv(H(飜ff.AVAUIATIUHSHHdH%(H$1蝁IHH艁AD=IILHL1H5JLHH1LʼnIHHHAHH5HYwHtL#E1HLnH$dH+%(HD[]A\A]A^@=ILLGH)E1E11H5!H81pefDHE1E1H8`fDHH5E1H81-e:ÙAVAUIATIUHSHdH%(H$1LHLID9L؁IMHHjL1E1ML$HHDL!LHFy t HL"AExMH$dH+ %(H[]A\A]A^fDHH5H81d1@HHLH5H81cH=ז莫HL蓰1w@HQLHH5eH81cH=N1B"fAUATIUHHt71ɺH;t,Mt:LHE1HAHHuE1HD]A\A]A1ɃHD$ܛH|$At'AMtLH|$E1uH|$HAHD]A\A]AVAAUIATUSHHdH%(H$1`HHH5'L{IHt}HHHj1HtIHHtH+1L H袁H$dH+%(HL[]A\A]A^El蝋IHtHH:uHOH54H81aMsdE1E1cDHLH5E1H81ba;DLE1 &HH5BH81(a辕ff.AT1LSHH 5HH蘂ttuAHD[A\DH{LH H UAąuHCH5 HH(HP L@0H H81v`@AHCH5HH(HP L@0HH81E`HD[A\f.AWAVAUIATIUHSHdH%(H$1{HH{Á%L$L1HHLaILL$H1L=ILHFH1!H5;CHxHHIuHE17HH<~RH5CLxHHAEH”H5HAHHD1^HH$dH+%(HD[]A\A]A^A_f.HYH5YE1H81^LXH1LH5vE1H81z^L(HLH5FH81M^RAWAVAUATIUHSHH(dH%(H$1yLIyHIyDEA9DLAL$H1HLL|$XMHH$HHH$1L$(IHH$HRHHD$1MHHL1L1IHHǖLHy賎t 3HLȩH4$L贩y`{tTtOHhH $LH5{H81\H=dLHiHL^1(f.H|$LCAEH$dH+%(H([]A\A]A^A_fHH5H81\1@HHLH5H81[H=覣HL諨1r@HiLHH5}H81[H=f1=H1HT$LH5CH81x[H=u,H<$L0fDHt;UHHn|H}H5tH]H5t@ff.@Ht&0IwH HcHf1ff.fAWIAVAUATUSH(?/Ht$T$ kIHMwH5CLqHHhAG1ۄ>I<=t&fIAEIA<=uAEAFM}IV1LH聇H ]LHj:A\LHDA]H5SA^1A_S]A\A]A^A_fDff.@H5) 餟@USH8dH%(HD$(1HmHE$HÅu(HfHD$(dH+%(u6H8[]fDNhH+OffH*H*^ڇf. ff.HHdH%(H$1HVoAEuD$%=@H$dH+ %(uHĨUDH?H8SHa@H8SUHSHHcH#aH[]ff.UHSHHcH3H[]ff.EHI?H8ATIH=ZUSLHdH%(H$1H=$L!u}H=L7A<$fA|$dxA|$:lI1 LzLH5H1H814QwfH-)HsIHLiŃtH= H LHtH5LhHH$dH+%(HH[]A\DILԀHHhH$dH+%(HHﺉ[H5]A\gfH$dH+%(hHI|$[H5]A\hgH=LHHHH^H57H81O1HH6蒉HmH5sH+bHdH<@IH5LhH>HHH˳LH5H81OWfHLH5wH81N5HH51H81NLH5z\ff.AVAUIATIUHSHHtWHtW]1LA@jHH~Eu?HLHIE[]A\A]A^fDHuHtVHHt1fD1 HHt!HuMt[]IEA\A]A^Ð[1]A\A]A^DHt1p@H;LtnAULǾATHyH=<I}IHt1H=HtF!kLH6`L1ҾHIHLA\A]D1LfDKH<Hff.@EH:H8HH=yHH1zfATISHMt=A<$-t.É LHeHH[A\fDA|$uʀrtKHu ~8rH.HHH5'1H;CLH;ۚH1[A\ÐHu}8:rHHfD}8rH Irt!H wtaH HHDHeLH51H;Kiff.ATrIUHHt*HLHdHIYHL]A\fDE1HL]A\f.ATUSHdH%(HD$1H$ /IHr-HH|uGIE111LHrH$HtMH衐H$HL$dH+ %(H[]A\H)LH5H81uJH$HuHH5eH;VJH;@Hq7H8YH0f.HY11H{H$F@1H~H$/DH1>H$(p~USHdH%(HD$1H$ t}rHHt$tru:111H[H$HtcH[H$HL$dH+ %(ujH[]HH5zH818IfDH1H$1HH$HH5H;HH;蒗z}AWAVL5AUIATLE1USHdH%(HD$1]A9@DLGHHHh fH9}HCGHt$Ht|$IuH蔗~L_LH€uHL$dH+ %(uVH H[]A\A]A^A_DLA脎A9+HD$dH+%(uH1[]A\A]A^A_E|DAWAVAUATUH`IHHL11ҾgHIwHH|L=4HILwMtRLLw~11ҾYL6HH;LHI=Mt LL=~]LA\A]A^A_LE1赋AUATMUHSH8dH%(HD$(1HL$HD$H|$HtnHھrHHt}MYx  H5HT$HfHD$4wHP3H88HHu1HHD$HHL$(dH+ %(H8[]A\A]fMM4L<~DHl$HuHCLH51H;EH;'{fHH5H81hE\HLH5H;GEH;ߓHD$DD1H趆HD$@HQHL$1HgHD$H)E1LHHL$LD$@HwHD$fDHIH5H81DH)H51H81vDjHLHL$H\LHD$txfAVAUMATUSH dH%(HD$1H $H|$Hھr(HH3 : nH 衉HJH;LH51E1CHD$dH+%(H L[]A\A]A^MHHHL {IH^1'D0'HH0H80H {fIHMTH1HqH5 H;1B1詈 @1HLI멐1HIHtJyNIHt LH&^L~qfHH1HlCIHuH,HզHiH1H\I@1HSDHH5DHyLH5%1H;AH;]1覇Lvff.AVAUATUSH dH%(HD$1H$H|$tCH HH5rH81XA1HL$dH+ %(H []A\A]A^DrMMKH1HtHJ1HHmNHIMt I}Mt I>1bL?H0HHtMtI}wHHsHtMtI>w(HCL9|MtH5-L_DMI>迆H5,L,H5M-I>IH^hXIEHH5,LH5j-I}كIEMtH5,I>轃IH)HH51H;g?H;1H5),LqMxH5+LH5+LɂH5J,I}蹂IEH$sIE1ɉHLMf.IHLE1ff.fAVAUATAUHSH?-AH1DAŅAH5_IHLpIHuEHo8cIH2MHHH51H;x=H;L{[L]A\A]A^@F[DHw]A\A]A^ffDH5 2_IHtZSn8$cILL-MHHH5}1E1I}HCH[]fHH8aHHuBH[]DHH51H;;H;訉HBH1[]H|ff.@AWAVAUIATUSHH5sHdH%(H$1 THH1ҾkHL$HH|$:HT$ojH)=IHL$L1HLsLDH5I LxIHA$Mt'LHo1qHHtA$5H5LQoD$oL$ oT$0o\$@ID$od$Pol$`AD$ot$pAL$(o$o$AT$8A\$HAd$XAl$hAt$xA$A$L@1^ZH6oH$dH+%(HĸL[]A\A]A^A_f.D{jH A]qL1H 1H5-mH9E1E1H8+IfDE1E18mAV1AUATUHSHdH%(H$1Ld$Ljt H|$Hu.H$dH+%(HĠ[]A\A]A^H5LHHIjHl$1HHH|$E1E1fDKc|D9GDM$CLII?)HHJ DL9t$w1HDE11A H5LP@ H5LPE1kff.HcHWtAVAAUIATIUHHtH=#lHuMLb1H{UHtMMtYLMLH~dH]A\A]A^f.LaHHMduH1]A\A]A^LM11DHqNHH]A\A]A^ff.USHt(H+OHHHE]uH[]@ATIUH/t3HHH9r'H=#^nH7[fDHHSH>HH5:(H|HHHtIH5Z11ɿfH9tH;t 8HDDHCHHuۄtH Hi[AUHATUSHL%I<$HtzH;H1H5HH-H<L-c]Hu6fDHSHHt#HcCHtI<$L1H-HHuH1[]A\A]HH5J1c-H1[]A\A]fD1HH=$HH= HH5HHT$bHT$aH5iHbHT$ED1H]A\fD1D<@볐@  f@ƀH= HtH= H@fD@ fD@trftX At:f.Atf.HLH]A\At wDATISHH`AHHtHD[A\DHLHH5H81>*HE1D[A\ATISHH;AHHtHD[A\DHLH?H5H81)HE1D[A\AUATIUHSHH>Ht8IH H{HHt#Lk_uCAEH[]A\A]HHªH5&1H;a)HUHt"L%oH;L1H?)HUHuH1[]A\A]fAUATIUHSHdH%(HD$1Z1HHD(HQH$:uAH9t#H=ŤHt$MEH HYH50DH=H uH&H5î{f.H=QHt$ HDH=1Ht$(gfH=Ht$OGfJT%Ht0HVLHH5+LHlH5HATUHdH%(HD$1H$wSHCHHcHE1DHD$dH+%(HD]A\f Hc1Ac1HMHHEHA_>D@HA1xHA0`1 HIqHA)'HA0HA0HAm0HAM0HA-0@HA 0pHA/P HA/0HA/ HA/HAm/HAM/HA-/HA /p HA.PHA.0HA.HE1H+Af1HE1HgAk1HE1H;nAKHHAąH4$HA#/vfD1 HFHA,?H1HHHAYT @H<DžxN\H8HfJAąvHϞH5HHH81dJHH5pHHE1H815xHtH5YHH\H5HQff.HyHaHciHjHff.fHE1H8tHAH8uDHAWAVAUATUSHHxL?dH%(HD$h1ML-@IALL9t.F7A~ h-tH-7lD9DOI~IHuHHD$I9AH-6f IcH}LLDH511L{HM<LkHMLDL;|$ofoD$`Lt$HjD$D$ D$0D$@D$PH9wH3D$->{ -D$*WHD$ { LxLHUTL6LHL)H}L1H5foۭAFP AAFAF AF0AF@fAH-CHH5ݨ1H}L;MtHsHD$HD$hdH+%(uZHx[]A\A]A^A_ÐL|$OLFLF5L{ -@H}HeL1 INH t)~_H]?t~@H]HEHtHHEf.HĬt~+HHEHattHHESH5yHX;HxHHHHH@P1H)XHHHBHHHBHHt HJHPP[B[ff.AWEAVAAUATULSH0L$H\$hdH%(HD$ 1SSZYAŃu {H;H5)L%qMt Hvq@L`HMtD;puAA A t]AtWA uHzHHz@HPHHD;xuH;H5!1EH5OH;H*HHH;J(T$H;H51 ==uHtR[H;H(iHHHHHD$@111ILD$1 ;HHT$H;H5ǩ1M^Hk@1fH(`H;H5S1D}EH;AAM(LH5&1HqHtWHqfDHPHHt;D9xuH;H5\1H-H;H&UH pHpuHuHHHHt;PuHGpHH7pDHPHHtm;puH;Ht`H5|1 D;ZHDf1= D}EH;AADH5ʷ1H;DH5/1(I1M6MH=1Ht4HHH5u1OH=11Ҿ HYfDHxH5bH81AWAVAUATUSHHH|$E]H@@IH[HHuD$HmxL5L-IL$8IT$0It$(H|$D$D|$5*H;H5D1芜I|$(IPH;1LHM[H;H5Q$HmHHt1I@LA#GH;IEH51IIHuH;H51H|$11ҾcTH5H֪H;HE$u*Md$PMH[]A\A]A^A_It$(H|$QBt?It$0H|$Xt,AD$@uQIL$8HtH|$X3THu1H[]A\A]A^A_DH;H5 1SfH|$11ҾiSH:1AWAVAAUATIUHHSH8T$dH%(HD$(1=$EtVHE1E11j11L,LD$A[A]HD$(dH+%(H8[]A\A]A^A_fHE1E11j1ҾLSD$AYAZt_H56H"D$EHD$1L|$HD$Lt$ Ll$$kfDHLMt$E1LLbKY^tH5RH"|$$HHtLHH51|$ uQ;$tj|$uHLME1t$LLuXZ두T$HH5{1J|$ tRUH5[HH1&;$uHD$(dH+%(urH8HH5[]A\A]A^A_T!@T$H5 H1BDH5̣H!!@H5H !r:Df.AWAVAUATIUSHHLITLAHfhxtt+H ׵HcHL5s1DH5NI>MLHD$LI>HL$1HVI>H5ܻ9 uHc-LI>H5H1Hgx D9 HgE1p hAǃ+HǵHcHA߃ugucHmgPt~HD[]A\A]A^A_@L5rI>H5V1(LJI>HAI>H51Et*f.I>H5!A@L`Hf@hHWrDH5H81 HfDHf@+w-HzHcHH|fDxEE1L5qAI>H5BLIgI>1LHUI>H5 hE*f.AHeHLcfDL5aqI>H5Ӆ1 L<DDWE1BAUATUHtAIպHI~?MHMDL:~|H\BAątMAD]A\A]fDH-pLH5H}1E1 H}ZD]A\A]HpH5¯H81 fDH-apLH5wDAVE1HAAUAATUSHtbHIIDLH*~MHAAŅMtLXH HuCA[D]A\A]A^ÐHoH5H;1E1 H;Y[D]A\A]A^Ð1Ic־iHN HuHroH5GfHYoH5+HIoH5H81 fH)oH5H;E1w H;Y=f.AWAVAUATIHUHSH(dH%(HD$1Ll$t{1HL.HL1LlHKHt |$+LH0/HD$dH+%(rH([]A\A]A^A_L1ҾgHKHÅhH5;LDsE1HlfDHD$LB8MH{lfL@HM;PuMtH59LLD$qLD$LLaIGM9I|$H5ΝLH1fD NH5LH1fMtH5LT$T$H5GL1sIGM9rH5]L',ff.AWAVAUATIUHSH8dH%(HD$(1.HurL9H5PHI1FMtLH5FH1-1HT$LNDyJHD$(dH+%(H8[]A\A]A^A_HH4H5HH1fHL$HT$LHD$Ht$ LL$ HD$ LD$ 1L|$ AI HD$H5J\8耂H IHpHHHBCBH9uH|$AD$HH|$ HL$HL H5LFT$ HAUP1ATDD$/H LH5<:DO4?H\$I~I9H5э螁IMtvJ4;HH ˍHHBCBH9uMAH|$HEHՌHHDI)QLH5gHHYH81fAWAVAUATUHSHdH%(HD$1:?HCYH5H1H;HHHo H;H5H1[H;1H^H*IHH;H56}LI1H;L1HI;H;H5Y1LlH5HLH#H3H0L`DH;HmH%t9HD$dH+%(H;HH[]A\A]A^A_OHD$dH+%(H;HH[]A\A]A^A_ <$H5 )H;H1L<$X8H;H5̋H1LH911ҾnH4H.1ҾnHH4H;H56IMH4$HE1L5}IMtPLj H;HH$IHpH4$M9HIMtH;H53MuH$H;f8uH5?hfDLXH$H;H51H$H;H5P1cfH;H5-@H;H5/&LH5H=AVIAUATUHHS16fDH6sHI(LLHI~3H79|L|"AątUA[]DA\A]A^HUH;MtaLLH5ډ1H;E1b?[D]A\A]A^fDHIUH5߉H;H;2?[D]A\A]A^fDLH51off.fAUAATUHS1HI@H#LHhH69|EuH[]A\A]L(H[]A\A]AWAVIAUIATMUSHH|$I u7MM Lv2Ln2H[]A\A]A^A_DIHL*IHLHHE1*Ņt1H߃3LHxH59|H|$LjD$PJL1=@1IH7LLH)ŅH|$Lk!@E11ff.H)SUH57pHH%pHH5HpzHH5p]3f.ATIUHHH=o7$HoHtWMtRLH5j/cHoHHtt11Ҿv3t2HH5hH1]A\f1H]A\fDH=qoH5jH=^o11Ҿ 3fDHRLH5ņH81eff.AVAUIATIHUSHLHHEIHtHH3uLt{[]A\A]A^fLH5L11L-љ6uHIL1LH4LL HC39|[]A\A]A^fD[L]LH5qA\1A]A^d@AWAVEAUIATE1UHSHHHH $LD$dH%(HD$81HD$(HD$0t.HD$8dH+%(HHD[]A\A]A^A_HAD1HD$0HHPD$D$AXAYWH$H D$Hl$(H$D$D1ۉD$Eus$$L|$0MFfDL8 H. 9tZLIHu1HHHEtH D9taH5H=:f.HD$SHD$H T$1ɉމAEQL A}HjH T$A}HA}H|$0 D$H|$H-+H$HH|$(HHDH$H t.H|$(HtH|$(HHEHINH $I1LL$H5lH;7lDHD1HD$8PD$D$Ht$H|$^_HME1H87&@L HMH;E17H|$0Ht H|$( HHD$,HD$T$t$1ɉOAEHII H8;$GfDH;$fD HfDHLE1H86+fA}LAEHHD$HD$A}AE{ff.AWE1AVEAUEATIUSH8H$pH$L$8H|$H$H$xHt$HD$dH%(H$(1HD$Ht.H$(dH+%(H8D[]A\A]A^A_fHEEHD$PLPL$HH|$(:ZYADž D$8H|$HEEtyD9H|$HH|$HE1AH|$HJH|$HD$ H|$HHD$(-A AHGd$HtHD$0H|$09T$ 1DÃnDLd$(LADžuUH|$H HJH84 HgHD$ |$8NH\$ H;IHDLH|$HA HD$HfE  HD$PHt1HT$PE1E111H +L4H5C5H52LH|$P kf;;D$8H|$H+[D9H|$HHIH83~@H|$H HgIE1H8\3HfHD$ H|$fH5H111Ҿ H)HD$HtHKfDt$$HD$ =HL$T$DH$A1tESKAuLt$ I>XSIHH*Ld$ D3I4$1>DžxAƾLd$`VT$DH$HL$оDADAV\$(Ht$PD|$0HIcIDl$<$HAHHD$PHD$X H$@DH~1L1HH011MLDH \`D\$(D|$0Dl$<$  @K;D$ H|$0;AA 'DDH|$P.IHH|$P!IH:LLLHHH5 HHE1 }11H 'L4H5]L5H5IH|$PLE1 HIFH8A0@AH.FH8&0_ yH|$0 A HD$(H5H=:DAWL=AVIAUIATAUH-SL)HHt1LLDAHH9uH[]A\A]A^A_HH%s: Memory allocation failure output file (output format is always DER)dump the first arg bytes of unknown data in hex formoffset; a series of these can be used to 'dig'into multiple ASN1 blob wrappingsstring to generate ASN1 structure fromfile to generate ASN1 structure fromdo not attempt base64 decode outside PEM markers%s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1Can't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s ../apps/asn1pars.cDisplay this summaryinforminput format - one of DER PEMinput fileindents the outputnooutdo not produce any outputoffsetoffset into filelength of section in fileoidfile of extra oid definitionsunknown data in hex formdlimitstrparsegenstrgenconf(-inform will be ignored)strictpemitemitem to parse and print%$&$&&&%&&4($(('''','unspecifiedholdInstructionCAkeyTime../apps/ca.cMemory allocation failure row exp_datarow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s Revoking Certificate %s. Invalid object identifier %s revocation reasonUnknown CRL reason %s NULLValidRevokedExpiredundefPRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'\0x%02X^%coptionalsuppliedmatchType :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: (%ld days)Sign the certificate? [y/n]:row expdaterow spaceerror unpacking public key Signature ok memory allocation failure invalid revocation date %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s invalid reason code %s todayUsing configuration from %s default_caoid_filestring_maskutf8yesunique_subjectdatabaserow serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA private keyCA certificatepreservemsie_hackname_optInvalid name options: "%s" cert_optcopy_extensionsnew_certs_dir%s: %s is not a directory in entry %d generating index Updating %s ... %s=Expired Malloc failure newdefault_mdno default digest email_in_dnnomessage digest is %s policy is %s rand_serialx509_extensionsdefault_startdatedefault_enddatedefault_daysnext serial number is 00 next serial number is %s error on line %ld of %s CERTIFICATION CANCELED writing new certificates writing %s Data Base Updated crl_extensionscrlnumberdefault_crl_daysdefault_crl_hoursmaking CRL error setting CRL nextUpdate signing CRL no input files keyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationcertificateHoldremoveFromCRLA config filesubjcreate_serialmultivalue-rdnCert notBefore, YYMMDDHHMMSSZThe CA 'policy' to supportPrivate keypassinInput file pass phrase sourceThe CA certselfsignoutdirWhere to put output certnotextbatchDon't ask questionspreserveDNDon't re-order the DNnoemailDNgencrlGenerate a new CRLcrldayscrlhourscrlsecinfilesss_certspkacrevokeRevoke a cert (given in file)validextfileupdatedbUpdates db for expired certcrlextscrl_reasoncrl_holdcrl_compromisecrl_CA_compromisewriterandAdding Entry with serial number %s to DB for %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Invalid time format %s. Need YYYYMMDDHHMMSSZ Error in revocation arguments variable lookup failed for %s::%s invalid type, Data base error The Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Extra configuration file found ERROR: adding extensions in section %s Successfully added extensions from file. Successfully added extensions from config ERROR: adding extensions from request The subject name appears to be ok, checking data base for clashes ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED The matching entry has the following details Error reading certificate request in %s Check that the request matches the signature Certificate request and CA private key do not match Signature verification problems.... Signature did not match the certificate request Invalid global string mask setting %s CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error Loading extension section %s start date is invalid, it should be YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ end date is invalid, it should be YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ cannot lookup how many days to certify for error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error Loading CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Verbose output during processingThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8 (default ASCII)If reading serial fails, create a new random serialAlways create a random serial; do not store itEnable support for multivalued RDNsYYMMDDHHMMSSZ cert notAfter (overrides -days)Number of days to certify the cert formd to use; one of md2, md5, sha or sha1Private key file format (PEM or ENGINE)Key to decode the private key if it is encryptedSign a cert with the key associated with itThe input PEM encoded cert request(s)Where to put the output file(s)Signature parameter in n:v formDo not print the generated certificateDon't add the EMAIL field to the DNmsie modifications to handle all those universal stringsDays until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueThe last argument, requests to processFile contains a self signed cert to signFile contains DN and signed public key and challengeAdd a Valid(not-revoked) DB entry about a cert (given in file)Extension section (override value in config file)Configuration file with X509v3 extensions to addShows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseLoad the file(s) into the random number generatorWrite random data to the specified fileUse engine, possibly a hardware deviceH:@7<<:P?@?`?:0? ??>>>>> :>p>`> >>======h=0123456789ABCDEFUNKNOWNOpenSSL cipher name: %s Error in cipher list 0x%02X,0x%02X - %s - Even more verboseOnly supported ciphersTLS1 modeTLS1.1 modeTLS1.2 modeTLS1.3 modestdnameShow standard cipher namespskconvertciphersuitesError setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - Verbose listing of the SSL/TLS ciphersinclude ciphersuites requiring PSKinclude ciphersuites requiring SRPConvert standard name into OpenSSL nameConfigure the TLSv1.3 ciphersuites to useiijjjjj|jlj\jLj%08lx lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL Input format; default PEMInput file - default stdinOutput format - default PEMoutput file - default stdoutPrint issuer DNlastupdateSet lastUpdate fieldnextupdateSet nextUpdate fieldNo CRL outputPrint the crl fingerprintPrint CRL numberbadsiggendeltaVerify CRL signaturePrint hash valuenameoptAny supported digestError initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key CRL signing Private key to useCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file namePrint out a text format versionVarious certificate name optionsPrint old-style (MD5) hash value|lD,ԇćlTD4$Ćunable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object Input format - DER or PEMOutput format - DER or PEMnocrlGldTD4No crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedRSA-%-25sRead Error in %s Verified OK Verification Failure Error Verifying Data Signature bufferError Signing Data \ *%s ../apps/dgst.c-%s%s(%s)= etaonrishdlcupfmI/O bufferSupported digests: MAC parameter error "%s" Error generating key Error getting context Error setting context Error setting digest signature bufferList digestsSign digest using private keyprverifyFile with signature to verifyPrint as hex dumpPrint in binary formPrint debug infofips-fingerprinthmacCreate hashed MAC with keymacoptengine_impl%s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and Signing key cannot both be specified Key type not supported for this operation Error opening signature file %s Error reading signature file %s Usage: %s [options] [file...] file... files to digest (default is stdin) Print the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutVerify a signature using public keyVerify a signature using private keyKey file format (PEM or ENGINE)Compute HMAC with the key used in OpenSSL-FIPS fingerprintCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyAlso use engine given by -engine for digest operationsPp`@(ț؜ȜX(unable to load DH parameters WARNING: q value is invalid WARNING: j value is invalid print a BNstatic DH *get_dh%d(void) { dhpdhg return dh; } ../apps/dhparam.cUsage: %s [flags] [numbits] Input format, DER or PEMOutput format, DER or PEMCheck the DH parametersPrint C codedsaparamgenerator may not be chosen for DSA parameters Generating DSA parameters, %d bit long prime Generating DH parameters, %d bit long safe prime, generator %d This is going to take a long time unable to load DSA parameters WARNING: p value is not prime WARNING: p value is not a safe prime WARNING: q value is not a prime WARNING: unable to check the generator value WARNING: the g value is not a generator DH parameters appear to be ok. ERROR: Invalid parameters generated DH *dh = DH_new(); BIGNUM *p, *g; if (dh == NULL) return NULL; p = BN_bin2bn(dhp_%d, sizeof(dhp_%d), NULL); g = BN_bin2bn(dhg_%d, sizeof(dhg_%d), NULL); if (p == NULL || g == NULL || !DH_set0_pqg(dh, p, NULL, g)) { DH_free(dh); BN_free(p); BN_free(g); return NULL; } if (!DH_set_length(dh, %ld)) { DH_free(dh); return NULL; } unable to write DH parameters Print a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 5 as the generator valueRead or generate DSA parameters, convert to DH@xx`hȝ.+* Error getting passwords read DSA key Public Keyunable to load Key Public Key=writing DSA key unable to write private key ../apps/dsa.cInput format, DER PEM PVKOutput format, DER PEM PVKInput keyDon't print key outPrint the key in textPrint the DSA public valuepubinpuboutpassoutpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingPVK form impossible with public key input bad output format specified for outfile Expect a public key in input fileOutput public key, not privateOutput file pass phrase sourceEnable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding levelܤܥ̥|l<,Error allocating DSA object This could take some time BN spacedsapdsaqdsag../apps/dsaparam.cPrint as textOutput C codeNo outputgenkeyGenerate a DSA keyWarning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating BN_GENCB object Error, DSA key generation failed static DSA *get_dsa%d(void) { DSA *dsa = DSA_new(); BIGNUM *p, *q, *g; if (dsa == NULL) return NULL; if (!DSA_set0_pqg(dsa, p = BN_bin2bn(dsap_%d, sizeof(dsap_%d), NULL), q = BN_bin2bn(dsaq_%d, sizeof(dsaq_%d), NULL), g = BN_bin2bn(dsag_%d, sizeof(dsag_%d), NULL))) { DSA_free(dsa); BN_free(p); BN_free(q); BN_free(g); return NULL; } return dsa; } unable to write DSA parameters ȥpȨ`xXH(.+* read EC key EC Key valid. EC Key Invalid! writing EC key ../apps/ec.cPrint the keyparam_outno_publiccheck key consistencyparam_encconv_formnamed_curveuncompressedhybridܬ̰|l\L<,ܯPrint the elliptic curve parametersexclude public key from private keySpecifies the way the ec parameters are encodedSpecifies the point conversion form CURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 unable to load elliptic curve parameters checking elliptic curve parameters: Can only handle X9.62 prime fields EC_GROUP *get_ec_group_%d(void) { int ok = 0; EC_GROUP *group = NULL; EC_POINT *point = NULL; BIGNUM *tmp_1 = NULL; BIGNUM *tmp_2 = NULL; BIGNUM *tmp_3 = NULL; if ((tmp_1 = BN_bin2bn(ec_p_%d, sizeof(ec_p_%d), NULL)) == NULL) goto err; if ((tmp_2 = BN_bin2bn(ec_a_%d, sizeof(ec_a_%d), NULL)) == NULL) goto err; if ((tmp_3 = BN_bin2bn(ec_b_%d, sizeof(ec_b_%d), NULL)) == NULL) goto err; if ((group = EC_GROUP_new_curve_GFp(tmp_1, tmp_2, tmp_3, NULL)) == NULL) goto err; if ((tmp_1 = BN_bin2bn(ec_gen_%d, sizeof(ec_gen_%d), tmp_1)) == NULL) goto err; point = EC_POINT_bn2point(group, tmp_1, NULL, NULL); if (point == NULL) goto err; if ((tmp_2 = BN_bin2bn(ec_order_%d, sizeof(ec_order_%d), tmp_2)) == NULL) goto err; if ((tmp_3 = BN_bin2bn(ec_cofactor_%d, sizeof(ec_cofactor_%d), tmp_3)) == NULL) goto err; if (!EC_GROUP_set_generator(group, point, tmp_2, tmp_3)) goto err; ok = 1; err: BN_free(tmp_1); BN_free(tmp_2); BN_free(tmp_3); EC_POINT_free(point); if (!ok) { EC_GROUP_free(group); return NULL; } return (group); } unable to write elliptic curve parameters unable to set group when generating key Input format - default PEM (DER or PEM)Print the ec parameters in text formPrint a 'C' function creating the parametersPrints a list of all curve 'short names'If 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'list curves../apps/ecparam.c %-10s: secp192r1secp256r1unknown curve name (%s) unable to create curve (%s) Can't allocate BNBN bufferec_pec_aec_bec_genec_orderec_cofactor /* build generator */ unable to generate key Input file - default stdinOutput file - default stdoutValidate the ec parameterslist_curvesno_seedDo not print the ec parameterGenerate ec key̪|̭td̮L non-hex digit base64%s is not a known cipher Supported ciphers: %s Can't read key from %s Extra arguments given. %s XTS ciphers not supported bufsize=%d strbufevp bufferencryptiondecryptionenter %s %s password:bad password read invalid hex salt value error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=key=iv =bad decrypt bytes read : %8ju bytes written: %8ju ../apps/enc.c%s: zero length password List ciphersAlias for -listPassphrase sourceEncryptDecryptPrint the iv/keyPrint the iv/key and exitVerbose outputnopadUse salt in the KDF (default)nosaltDo not use salt in the KDFSame as option -abufsizeBuffer sizePassphrasekfileRead passphrase from fileRaw key, in hexSalt, in hexivIV in hexpbkdf2Don't encrypthex string is too long, ignoring excess hex string is too short, padding with zero bytes to length %s: AEAD ciphers not supported *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Disable standard block paddingBase64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineUse specified digest to create a key from the passphraseSpecify the iteration count and force use of PBKDF2Use password-based key derivation function 2صp`P8(`P@0 صpxP Salted__engine buffer../apps/engine.cSTORE(%s)[Success]: %s [Failure]: %s Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] description buffer%s%s(input flags): [Internal] NUMERIC|STRINGNO_INPUT<0x%04X> engine... Engines to load vvvvttprepost[Error]: internal stack error [Error]: command name too long %s: Cannot mix flags and engine names. Usage: %s [options] engine... List 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineCheck that specified engine is availableDisplay error trace for unavailable enginesRun command against the ENGINE before loading itRun command against the ENGINE after loading itCommands are like "SO_PATH:/lib/libdriver.so"x%lx errnum Error number Usage: %s [options] errnum... Generating DSA key, %d bits ../apps/gendsa.cunable to load DSA parameter file Usage: %s [args] dsaparam-file Output the key to the specified fileEncrypt the output with any supported cipherxAlgorithm already set! Algorithm %s not found Parameters already set! Can't open parameter file %s Error initializing context %s: No keytype specified. Error generating parameters Bad format specified for key Error writing key Error printing key ../apps/genpkey.coutput format (DER or PEM)paramfileParameters fileThe public key algorithmpkeyoptgenparamGenerate parameters, not keyPrint the in textError initializing %s context Error reading parameter file %s %s: Error setting %s parameter: %s: cipher mode not supported Set the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. |E \4 e is %s (0x%s) ../apps/genrsa.cUse 3 for the E valueF4f4Specify number of primesWarning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Generating RSA private key, %d bit long modulus (%d primes) Use F4 (0x10001) for the E valueOutput the key to specified file4<toseqOutput NS Sequence file%s: Error reading certs file %s %s: Error reading sequence file %s |l\l%.*s../apps/ocsp.c%s: GET HTTP/1.POST Error parsing OCSP requestError creating connect BIO Error creating SSL context. Error connecting BIO Can't get connection fd Timeout on connect HostUnexpected retry condition Timeout on request Select error (core dumped)%s Error parsing URL issuer certificateError Creating OCSP request Error reading OCSP request Error setting up accept BIOError starting acceptresponder certificateresponder private keyresponder other certificateschild PID arrayfatal: waitpid(): %sfatal: RAND_poll() failedterminating on signal: %dindex file changed, reloadingsigner private keysigner certificatesError signing OCSP request assertion failed: bnError reading OCSP response Responder Error: %s (%d) validator certificateError parsing response Nonce Verify error Response Verify Failure Response verify OK ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: Output filenameResponder URLPort to run responder onignore_errDon't verify response at allAdd OCSP nonce to requestno_nonceresp_no_certsresp_key_idno_signature_verifyno_cert_verifyno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internreq_textPrint text form of requestresp_textPrint text form of responsereqinrespinVAfileValidator certificates filesign_otherverify_othervalidity_periodstatus_ageMaximum status age in secondssignkeyreqoutrespoutPath to use in OCSP requestIssuer certificateCertificate to checkSerial number to checkindexCertificate status index filenminnrequestndaysrsignerrotherrmdrsigoptkey=value header to addInvalid request -- bad URL: %sInvalid request -- bad HTTP version: %sInvalid request -- bad URL encoding: %sCould not allocate base64 bio: %sInvalid request -- bad HTTP verb: %sError querying OCSP responder No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. fatal: error detaching from parent process group: %sfatal: internal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%swaiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate WARNING: no nonce in response WARNING: Status times invalid. fatal: internal error: no free child slotsConnection timeout (in seconds) to the OCSP responderTCP/IP hostname:port to connect toIgnore error on OCSP request or response and continue runningDon't add OCSP nonce to requestDon't include any certificates in responseIdentify response by signing certificate key IDrun multiple responder processesDon't include any certificates in signed requestDon't check signature on responseDon't check signing certificateDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerCorrupt last byte of loaded OSCP response signature (for test)Print text form of request and responseFile with the DER-encoded requestFile with the DER-encoded responseCertificate to sign OCSP request withAdditional certificates to include in signed requestAdditional certificates to search for signerTrusted certificates directoryMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseNumber of minutes before next updateNumber of requests to accept (default unlimited)Number of days before next updateResponder certificate to sign responses withResponder key to sign responses withOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formAny supported digest algorithm (sha1,sha256, ... ),|l4t\\DL4  t\D, l$lL, \HTTP/1.0 200 OK Content-type: application/ocsp-response Content-Length: %d quitbye--helpUsage: %s Standard commands %-*s%s => %s ExternalBuiltin(none)Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Disabled algorithms: HEARTBEATS IDEA MD2 MDC2 RC5 SCTP SSL3 ZLIB %s %s %s * %s %c OpenSSL> OPENSSL_CONF../apps/openssl.cconfig filename bufferOPENSSL_DEBUG_MEMORYOPENSSL_FIPSFIPS mode not supported. Can't parse (no memory?) Usage: help [options] help [command] List in one columnList of standard commandsdigest-commandsdigest-algorithmscipher-commandsList of cipher commandscipher-algorithmsList of cipher algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsdisabledList of disabled featuresmissing-helpasn1parsecmscrl2pkcs7dgstdhparamecparamerrstrgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeyparampkeyutlrehashrsautls_clients_servers_timesess_idsmimespeedstoreutlx509md4gostsha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdes3desxrc4rc4-40rc2bfcastdes-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcsm4-cbcsm4-ecbsm4-cfbsm4-ofbsm4-ctrInvalid command '%s'; type "help" for a list. Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) FATAL: Startup failure (dev note: apps_startup() failed) FATAL: Startup failure (dev note: prog_init() failed) List of message digest commandsList of message digest algorithmsList missing detailed help stringsList options for specified commandL   T ,(t'))t)L(*)))*|*d*L*4**rounds=$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz../apps/passwd.capr1salt bufferrounds=%u%s %s Password: Read passwords from fileNo warningsFormat output as tablereverseSwitch table columnsUse provided saltRead passwords from stdinMD5-based password algorithmaixmd5Warning: truncating password to %u characters %s: Can't combine -in and -stdin Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmStandard Unix password algorithm (default), , %s, %s, Iteration %ld, PRF %s, Iteration %ld../apps/pkcs12.c%02X %s: %s: Key bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Safe Contents bag PKCS7 Data PKCS7 Encrypted data: Enter MAC Password:Can't read Password Nothing to do! certificates from certfileError %s getting chain. Enter Export Password:Enter Import Password:MAC: , Iteration %ld nokeysDon't output private keyskeyexSet MS key exchange typekeysigSet MS key signature typeDon't output certificatesclcertscacertsOnly output CA certificatesAdd certificate chaintwopassnomacverDon't verify MACdescertcertpbeOutput PKCS12 filenoiterUse MAC iterationnomaciterDon't use MAC iterationnomacDon't generate MACLMKnodesDon't encrypt private keysmacalgkeypbePrivate key if not infileLoad certs from fileUse name as friendly nameCSPMicrosoft CSP namecanameInput filenamePEM-format directory of CA'sPEM-format file of CA's, Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password No certificate matches private key MAC length: %ld, salt length: %ld Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates Only output client certificatesDon't output anything, just verifyPrint info about PKCS#12 structureSeparate MAC, encryption passwordsEncrypt output with 3DES (default RC2-40)Certificate PBE algorithm (default RC2-40)Don't use encryption iterationAdd local machine keyset attribute to private keyDigest algorithm used in MAC (default SHA1)Private key PBE algorithm (default 3DES)Use name as CA friendly name (can be repeated)Set import/export password source30 53444,5L5<5\6L6<6,66 655777t7\7L7$76666666|6l655555|5\5unable to load PKCS7 object Don't output encoded dataprint_certsBBDBDDDDDtDdD\CPrint full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the input%s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key ../apps/pkcs8.cInput format (DER or PEM)Output format (DER or PEM)topk8Output PKCS8 fileUse 1 as iteration countnocryptv2Use PKCS#5 v2.0 and cipherUse PKCS#5 v1.5 and cipherv2prfSpecify the iteration counttraditionalscryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterDDGG\G %s %s%s%n%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s compatDo not remove existing linkscrtcer%s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s %s: error: skipping %s, cannot open file %s: warning: skipping %s,it does not contain exactly one certificate or CRL Usage: %s [options] [cert-directory...] Create both new- and old-style hash linksUse old-style hash to generate linkson`oPo@o0on../apps/req.cparam:Unknown algorithm %.*s Error setting RSA keysize %s '%s' too long %s [%s]:weird input :-( ----- _min_maxDN defaultDN valueAttribute defaultAttribute valueError adding attribute Can't find keygen engine %s Serial number supplied twice input_passwordoutput_passwordreq_extensionsdefault_bitsGenerating an EC private key Generating a %s private key Error Generating Key default_keyfileencrypt_rsa_keyencrypt_keyunable to load X509 request promptdistinguished_nameunable to get '%s' section Modifying Request's Subject old subject=ERROR: cannot modify subject new subject=Error getting public key Error printing certificate Modulus=unavailable Modulus=Wrong Algorithm typeunable to write X509 request Private key to useKey file formatOutput public keyNew requestRequest template filekeyoutFile to send the key toPrivate key password sourcenewkeySpecify as type:bitsnewhdrRSA modulusVerify signature on REQDon't encrypt the output keyDo not output REQreqoptVarious request text optionsText form of request(Required by some CA's)Set or modify request subjectOutput the request's subjectset_serialSerial number to useaddextreqextsprecertkeygen_engineKey Type does not match parameters Internal error: can't find key algorithm Error allocating keygen context Error initializing keygen context string is too short, it needs to be at least %d bytes long string is too long, it needs to be no more than %d bytes long You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. error, no objects specified in config file Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. Ignoring -days; not generating a certificate Using additional configuration from command line Error Loading command line extensions Error Loading request extension section %s private key length is too short, it needs to be at least %d bits, not %ld Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. writing new private key to stdout you need to specify a private key unable to find '%s' in config problems making Certificate Request Error adding poison extension Cannot modify certificate subject Error printing certificate request unable to write X509 certificate writing new private key to '%s' Do not ask anything during request generationOutput "NEW" in the header linesOutput a x509 structure instead of a cert requestNumber of days cert is valid forAdditional cert extension key=value pair (may be given more than once)Cert extension section (override value in config file)Request extension section (override value in config file)Add a poison extension (implies -new)Specify engine to be used for key generation operationswuzPz zzyywwp{@{0{{{zzz||||p|`|P|8|(||{{{{{{yyPy`xHx0xxwRSA key ok RSA key error: %s writing RSA key unable to write key ../apps/rsa.cInput format, one of DER PEMOutput a public keyRSAPublicKey_inInput is an RSAPublicKeyRSAPublicKey_outOutput is an RSAPublicKeyPrint the RSA key modulusVerify key consistencyOnly private keys can be checked Output format, one of DER PEM PVK|<\ܙD̙ ,ܗܗܗ|\Error getting RSA key hold rsa keyoutput rsa keyRSA operation error ../apps/rsautl.cInput is an RSA publicUse SSL v2 paddingrawUse no paddingpkcsoaepUse PKCS#1 OAEPSign with private keyx931Use ANSI X9.31 paddingEncrypt with public keyDecrypt with private keyInput is a cert carrying an RSA public keyUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verifyddtTD, ԟğԞĞOCSP response: no response sent response parse error SRP parameters: N= g=SRP param N and g rejected. SRP password bufferSRP user../apps/s_client.cSERVERINFO FOR EXTENSION %dpsk_client_cb created identity '%s' len=%d created PSK len=%ld Error in PSK client callback hexdecode NOT--- Certificate chain %2d s: i:Server certificate --- SCTs present (%i) SCT validation status: %s --- --- New, %s, Cipher is %s Server public key is %d bit Compression: %s Expansion: %s Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: --- Reused, Can't use SSL_get_servername mail.example.comlocalhost%s: out of memory cbufsbufmbufNot a hex number '%s' %s: Can't use both -4 and -6 client certificate fileclient certificate chainError loading CRL Error adding CRL Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Unable to set SRP username Can't open session file %s Can't set session connect:errno=%d CONNECTED(%08X) Turned on non blocking io getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS ' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together %s: must not provide both -connect option and target parameter Cannot supply -nextprotoneg with TLSv1.3 %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -connect argument or target parameter malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument client certificate private key fileError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. MTU too small. Must be at least %ld Didn't find STARTTLS in server response, trying anyway... %s: HTTP CONNECT failed, insufficient response from proxy (got %d octets) %s: HTTP CONNECT failed, incorrect response from proxy Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect TCP/IP where to connect (default is :4433)bind local address for connectionConnect to via specified proxy to the real serverConnect over the specified Unix-domain socketTurn on peer certificate verificationCertificate file to use, PEM format assumedCertificate format (PEM or DER) PEM defaultPrivate key file to use, if not in -cert fileKey format (PEM, DER or engine) PEM defaultPrivate key file pass phrase sourcePEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsDrop and re-make the connection with the same Session-IDShow all certificates sent by the serverFile to send output of -msg or -trace, instead of stdoutConvert LF from terminal into CRLFIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Offer SRTP key management with a colon-separated profile listExport keying material using labelExport len bytes of keying material (default 20)Enable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Hostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Download CRL from distribution pointsCRL format (PEM or DER) PEM is defaultClose connection on verification errorRestrict verify output to errorsRestrict output to brief summary of connection parametersPrint session information when the program exitsEnable security debug messagesOutput more security debug outputCertificate chain file (in PEM format)Use dir as certificate store path to build CA certificate chainUse dir as certificate store path to verify CA certificateCA file for certificate chain (PEM format)CA file for certificate verification (PEM format)Do not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHelloHex dump of all TLS extensions receivedRequest certificate status from servertypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationUse specified configuration fileSize used to split data for encrypt pipelinesMaximum number of encrypt/decrypt pipelines to be usedDefault read buffer size to be used for connectionsDisable SSL/TLS compression (default)Disable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify TLSv1.3 ciphersuites to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modecert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM or DER) PEM default format of Extended certificate's key (PEM or DER) PEM defaultEnable send/receive timeout on DTLS connectionsFile to read PSK SSL session fromSRP username into second ClientHello messageTolerate other than the known g N values.Enable NPN extension, considering named protocols supported (comma-separated list)Specify engine to be used for client certificate operationsRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)Enable post-handshake-authenticationϖ6~ٗ~j<* K@P֝ 0͙ܙ *FVfuo 7IwӠ&^UƜ؜ .>Pbt֛"2D"AAa`ؓH`R]/v$Aؾu½϶϶/ !...%4ld items in the session cache %4ld client connects (SSL_connect()) %4ld client renegotiates (SSL_connect()) %4ld client connects that finished %4ld server accepts (SSL_accept()) %4ld server renegotiates (SSL_accept()) %4ld server accepts that finished %4ld cache full overflows (%ld allowed) Error waiting for client response HTTP/1.0 200 ok Content-type: text/html Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain '%s' is an invalid file name cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: SRP parameters set: username = "%s" info="%s" Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') ALPN protocols advertised by the client: Out of memory adding to external cache Unexpected session encoding length New session added to external cache Error setting session id context Error clearing SSL connection %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -www, -WWW, -HTTP, or -rev server certificate private key filesecond server certificate private key filesecond server certificate filesecond certificate private key filesecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback error setting PSK identity hint to context error setting session id context Cannot initialize SRP verifier file "%s":ret=%d TCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstTurn on peer certificate verification, must have a certCertificate file to use; default is server.pemTerminate after #num connectionsPEM serverinfo file for certificatePrivate Key if not in -cert; default is server.pemKey format (PEM, DER or ENGINE) PEM defaultSecond certificate file to use (usually for DSA)Second certificate format (PEM or DER) PEM defaultSecond private key file to use (usually for DSA)Second key format (PEM, DER or ENGINE) PEM defaultSecond private key file pass phrase sourceTest with the non-blocking test bioDon't use any certificates (Anon-DH)Disable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathServername for HostName TLS extensionmismatch send fatal alert (default warning alert)Certificate file to use for servername; default isserver2.pem-Private Key file to use for servername if not in -cert2Like -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argcertificate chain file in PEM formatsecond certificate chain file in PEM formatuse dir as certificate store path to build CA certificate chainuse dir as certificate store path to verify CA certificateDisable internal cache, setup and use external cacheNo verify output except verify errorsignore input eof (default when -quiet)Print more output in certificate status callbackStatus request responder timeoutFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkact as a simple test server which just sends back with the received text reversedConfigure SSL_CTX using the configuration 'val'A seed string for a default user saltListen for a DTLS ClientHello with a cookie and then connectSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)The maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protection%4ld session cache hits %4ld session cache misses %4ld session cache timeouts %4ld callback cache hits (NONE)Client certificate Shared ciphers:%s CIPHER is %s NEXTPROTO is Reused session-id Renegotiation is DISABLED ../apps/s_server.cserver www bufferLOOKUP renego during read LOOKUP done %s LOOKUP not successful GET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d 
<>&%-11s:%-25s
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory Error opening '%s' FILE:%s .html.php.htmrwrite W BLOCK GET /renegserver rev bufferCONNECTION FAILURE LOOKUP renego during accept CONNECTION CLOSED CLOSEcert_status: callback called cert_status: AIA URL: %s SRP username = "%s" User %s doesn't exist \x%02xHostname in TLS extension: "Switching server context. psk_server_cb identity_len=%d identity=%s PSK client identity found fetched PSK len=%ld Error in PSK server callback ALPN protocols selected: Lookup session: cache hit Lookup session: cache miss get sessionError encoding session get session bufferserver bufferUnable to create BIO Error reading early data Early data received: No early data received End of early data shutdown accept socket SSL_do_handshake -> %d Failed to initiate requestLets print some clear text LOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s Read BLOCK (Async) Read BLOCK shutting down SSL server2.pemserver.pemserver certificate fileserver certificate chainerror setting 'id_prefix' id_prefix '%s' set. Setting temp DH parameters unlinkSet session ID contextnacceptdcertDH parameters file to usedcertformdkeydkeyformdpassPrint more outputPrint the SSL statesnocertNo server outputno_resume_ephemeralwwwWWWservername_fatalcert2key2HTTPid_prefixdcert_chainno_cacheDisable session cacheext_cacheDo not ignore input eofstatus_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_fileOperate in asynchronous modePSK identity to expectpsk_hintPSK identity hint to usesrpvfileThe verifier file for SRPsrpuserseedJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3Use any DTLS versionEnable timeoutsSet link layer MTUlistenstatelessRequire TLSv1.3 cookiesJust talk DTLSv1Just talk DTLSv1.2no_dheDisable ephemeral DHrecv_max_early_dataAttempt to read early datanum_ticketsno_anti_replayhhhHw@@P@0?Qc%4`o 0?N^p,S @*7DTcr8Jrn}.N5Uj@.N]l}#8h```localhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingcafileJust time new connectionsJust time connection reuseCollecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection Now timing with session id reuse.Where to connect as post:port (default is localhost:4433)Cert file to use, PEM format assumedFile with key, PEM; default is -cert fileTurn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the site$$(((((p(`(P(@(0( (((''$p%@%GET %s HTTP/1.0 unable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Print ssl session id detailsOutput certificate Set the session ID contextOutput format - default PEM (PEM, DER or NSS)Don't output the encoded session info+r+0.+.-----,../apps/smime.cpk7outOutput PKCS#7 structurenochain%s: Must have -signer before -inkey Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAs00,31135544444444t4d4l300\3D322222<2$21<4333|3///////////////////////////////4444D5,544RSA sign failure RSA verify failure ECDSA sign failure ECDSA verify failure EdDSA sign failure EdDSA verify failure +R:%d:%s:%f %d %s's in %.2fs EVP error! Failure in the job Failure in the select +DTP:%d:%s:%s:%d rsa512dsa512ecdhp160+DT:%s:%d:%d +R1:%ld:%d:%.2f +R2:%ld:%d:%.2f +R3:%ld:%u:%.2f +R4:%ld:%u:%.2f +R5:%ld:%u:%.2f +R6:%ld:%u:%.2f +R7:%ld:%d:%.2f +R8:%ld:%u:%s:%.2f +R9:%ld:%u:%s:%.2f :%d%7d bytes:%.2f %11.2f %s: too many async_jobs %s: Maximum offset is %d shaopensslaescamelliaecdsaecdheddsa%s: Unknown algorithm %s %s is not an AEAD cipher array of loopargsECDH secret aECDH secret bfd buffer for do_multipipe failure Forked child %d dup failed Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+H:0123456789abmultiblock input buffermultiblock output bufferevp_cipher key../apps/speed.cevp+H+F:%d:%stype %-24s %11.2fk EVP_CIPHER_CTX_new failure EVP_CipherInit_ex failure privateECDH EC params init failure. ECDH keygen failure. ECDH key generation failure. ECDH computation failure. EdDSA failure. options: %s type +F:%u:%s%-13s+F2:%u:%u:%f:%f +F3:%u:%u:%f:%f +F4:%u:%u:%f:%f %30sop op/s +F5:%u:%u:%f:%f +F6:%u:%u:%s:%f:%f ECDSA failure. Ed25519Ed448secp160r1nistp192nistp224nistp256nistp384nistp521nistk163nistk233nistk283nistk409nistk571nistb163nistb233nistb283nistb409nistb571brainpoolP256r1brainpoolP256t1brainpoolP384r1brainpoolP384t1brainpoolP512r1brainpoolP512t1X25519X448ed25519ed448ecdhp192ecdhp224ecdhp256ecdhp384ecdhp521ecdhk163ecdhk233ecdhk283ecdhk409ecdhk571ecdhb163ecdhb233ecdhb283ecdhb409ecdhb571ecdhbrp256r1ecdhbrp256t1ecdhbrp384r1ecdhbrp384t1ecdhbrp512r1ecdhbrp512t1ecdhx25519ecdhx448ecdsap160ecdsap192ecdsap224ecdsap256ecdsap384ecdsap521ecdsak163ecdsak233ecdsak283ecdsak409ecdsak571ecdsab163ecdsab233ecdsab283ecdsab409ecdsab571ecdsabrp256r1ecdsabrp256t1ecdsabrp384r1ecdsabrp384t1ecdsabrp512r1ecdsabrp512t1rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360dsa1024dsa2048whirlpoolripemdripemd160aes-128-igeaes-192-igeaes-256-igeblowfishcast5ghashmd2mdc2hmac(md5)des cbcdes ede3idea cbcseed cbcrc2 cbcrc5-32/12 cbcblowfish cbccast cbcaes-128 cbcaes-192 cbcaes-256 cbccamellia-128 cbccamellia-192 cbccamellia-256 cbcaes-128 igeaes-192 igeaes-256 igeaeadmbmrRun benchmarks in parallelasync_jobselapsedmisalignToo many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs Doing %u bits %s %s's for %ds: Doing %s for %ds on %d size blocks: %ld %u bits private RSA's in %.2fs %ld %u bits public RSA's in %.2fs %ld %u bits DSA signs in %.2fs %ld %u bits DSA verify in %.2fs %ld %u bits ECDSA signs in %.2fs %ld %u bits ECDSA verify in %.2fs %ld %u-bits ECDH ops in %.2fs %ld %u bits %s signs in %.2fs %ld %u bits %s verify in %.2fs %s: %s is an unknown cipher or digest %s: async_jobs specified but async not supported -aead can be used only with an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbError creating the ASYNC job pool Error creating the ASYNC_WAIT_CTX Don't understand line '%s' from child %d Unknown type '%s' from child %d You have chosen to measure elapsed time instead of user CPU time. internal error loading RSA key number %d HMAC malloc failure, exiting...Async mode is not supported with %s Async mode is not supported, exiting...The 'numbers' are in 1000s of bytes per second processed. Generate multi-prime RSA key for %s RSA sign failure. No RSA sign will be done. RSA verify failure. No RSA verify will be done. DSA sign failure. No DSA sign will be done. DSA verify failure. No DSA verify will be done. ECDSA verify failure. No ECDSA verify will be done. WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during ECDH init. ECDH computations don't match. EdDSA verify failure. No EdDSA verify will be done. The 'numbers' are in 1000s of bytes per second processed.%18ssign verify sign/s verify/s rsa %4u bits %8.6fs %8.6fs %8.1f %8.1f dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits ecdh (%s) %8.4fs %8.1f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f ECDSA sign failure. No ECDSA sign will be done. EdDSA sign failure. No EdDSA sign will be done. Usage: %s [options] ciphers... Use EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceEnable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsUse wall-clock time instead of CPU user time as divisorSpecify number of primes (for RSA only)Run benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffers8Pp؀ɀQX~X~P~~x~H~ @ <This is a key...4Vx4VxVx4x4V4Vx4VxVx44Vx4VxVx4x4V4Vx4VxVx44Vx4Vx>`- ! @@ @@@@?../apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure challengeChallenge stringAlternative SPKAC nameDon't print SPKACVerify SPKAC signaturespksectԬ|l\L, Create SPKAC using private keyPrivate key file format - default PEM (PEM, DER, or ENGINE)Specify the name of an SPKAC-dedicated section of configurationValidating user="%s" srp_verifier="%s" srp_usersalt="%s" g="%s" N="%s" assertion failed: srp_usersalt != NULLInternal error validating SRP verifier Creating user="%s" g="%s" N="%s" Internal error creating SRP verifier gNid=%s salt ="%s" verifier ="%s" %s: Only one of -add/-delete/-modify/-list -srpvfile and -configfile cannot be specified together. Exactly one of the options -add, -delete, -modify -list must be specified. -passin, -passout arguments only valid with one user. trying to read default_srp in srp trying to read srpvfile in section "%s" Trying to read SRP verifier file "%s" No g and N value for index "%s" Database has no g N information. user "%s" does not exist, ignored. t Cannot create srp verifier for user "%s", operation abandoned . user "%s" does not exist, operation ignored. user "%s" already updated, operation ignored. Verifying password for user "%s" Invalid password for user "%s", operation abandoned. Cannot create srp verifier for user "%s", operation abandoned. user "%s" does not exist, operation ignored. t SRP terminating with code %d. The particular srp definition to useModify the srp verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userPass %s ../apps/srp.c%s "%s" %d = "%s" User entryg N entryNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Trying to update srpvfile. Temporary srpvfile created. srpvfile updated. User errors %d. Talk a lot while doing thingsThe srp verifier file nameAdd a user and srp verifiermodifydeleteList usersuserinfoаȮxhXHPPPPhXH8%*sCouldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. ../apps/storeutl.cNo PEM output, just statusSearch for certificates onlySearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by aliasRecurse through names%s: the store scheme doesn't support the given search criteria. ERROR: OSSL_STORE_load() returned NULL without eof or error indications This is an error in the loader %s: only one search type can be given. %s: can't parse subject argument. %s: can't parse issuer argument. %s: serial number already given. %s: can't parse serial number argument. %s: fingerprint already given. %s: can't parse fingerprint argument. %s: can't parse alias argument. %s: No URI given, nothing to do... %s: Unknown extra parameters after URI %s: both -issuer and -serial must be given. Usage: %s [options] uri Valid options are: Print a text form of the objectsSearch by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hex**8ؾXhX@00hdigest buffer../apps/ts.cError getting password. cannot convert %s to OID nonce buffercould not create nonce could not create query Verification: invalid digest string Error loading directory %s Error loading file %s FAILEDResponse is not generated. Response has been generated. Typical uses: orConfiguration fileGenerate a TS queryFile to hashDigest (as a hex string)tspolicyPolicy OID to useDo not include a noncePut cert request into querytoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileOutput text (not DER)Generate a TS replyqueryfileFile containing a TS queryFile with signer CA chainVerify a TS responsePath to trusted CA filesFile with trusted CA certsuntrustedFile with untrusted certsbad digest, %d bytes must be specified Warning: could not open file %s for reading, using serial number: 1 unable to load number from %s Error during serial number generation.could not save serial number to %s ts -query [-rand file...] [-config file] [-data file] [-digest hexstring] [-tspolicy oid] [-no_nonce] [-cert] [-in file] [-out file] [-text]ts -reply [-config file] [-section tsa_section] [-queryfile file] [-passin password] [-signer tsa_cert.pem] [-inkey private_key.pem] [-chain certs_file.pem] [-tspolicy oid] [-in file] [-token_in] [-out file] [-token_out] [-text] [-engine id]ts -verify -CApath dir -CAfile file.pem -untrusted file.pem [-data file] [-digest hexstring] [-queryfile file] -in file [-token_in] [[options specific to 'ts -verify']]Section to use within config fileFile with private key for reply Options specific to 'ts -verify': pH8`p`P@0[CRL path] %s: OK Chain:depth=%d: (untrusted)Recognized usages: %-10s %s Recognized verify names: %-10s untrusted certificatesother CRLsCRLfileshow_chain%serror %d at %d depth lookup: %s error %s: X.509 store context allocation failed error %s: X.509 store context initialization failed error %s: verification failed %s: Cannot use -trusted with -CAfile or -CApath Print extra information about the operations being performed.A directory of trusted certificatesA file of trusted certificatesA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadAttempt to download CRL information for this certificateDisplay information about the certificate chain<< Certificate purposes: %s%s : Yes (WARNING code=%d) No Yes CA/* * Subject: * Issuer: x509 name bufferthe_subject_namethe_public_keythe_certificate../apps/x509.cnotBefore=notAfter=Getting Private key Getting CA Private Key CA Private Keyserial# bufferadd_word failure Getting request Private Key request keyNo extensions in certificate Invalid extension names: %s UNDEFCertificate will expire Certificate will not expire unable to write certificate Print serial number valuePrint subject hash valueissuer_hashPrint issuer hash valueSynonym for -subject_hashPrint subject DNPrint email address(es)Set notBefore fieldSet notAfter fieldBoth Before and After datesOutput the public keyOutput certificate aliasNo output, just statusNo certificate outputocspidocsp_uriPrint OCSP Responder URL(s)trustoutOutput a trusted certificateclrtrustClear all trusted purposesclrextaddtrustaddrejectsetaliasSet certificate aliascheckendExit 1 if so, 0 if notSelf sign cert with argx509toreqCAkeyCAcreateserialCAserialSerial filePrint out C code formscertoptcheckhostcheckemailcheckipCAformCA format - default PEMCAkeyformCA key format - default PEMforce_pubkeynext_serialclrrejectsubject_hash_oldissuer_hash_oldpreserve_dates', L|\ https not supported GETError loading %s from %s %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectionargv spacepass phraseOut of memory User interface error aborted! copycopyall 0x000x%02X, }; unsigned char %s[%d] = { }; 0x%02X, autoenabling auto ENGINE support dynamicSO_PATHLOADinvalid engine "%s" SET_USER_INTERFACEcan't use that engine engine "%s" set. file name too long %s.%sunable to rename %s to %s %s.attr%s.attr.%sunable to open '%s' unique_subject = %s TrueFalseRequire explicit Policy: %s AuthorityUserNPN bufferpass:env:file:Can't open file %s Can't open BIO for stdin HARNESS_OSSL_PREFIX(doing something)writingreadingappendingCan't open %s, %s Can't open %s for %s, %s unable to load certificate http://no keyfile specified no engine specified cannot load %s from engine unable to load %s ')fstat('new DBallocate async fdsesc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamespace_eqdump_unknownRFC2253onelineca_defaultcompatibleno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumpassertion failed: mode == 'a' || mode == 'r' || mode == 'w'Error loading PKCS12 file for %s Passphrase callback error for %s Mac verify error (wrong password?) in PKCS12 file for %s OpenSSL application user interfaceproblem loading oid section %s problem creating object %s=%s %s: Could not allocate %d bytes for %s static unsigned char %s_%d[] = {error converting serial to ASN.1 format error converting number from bin to BIGNUM error creating serial number index:(%ld,%ld,%ld) error creating name index:(%ld,%ld,%ld) name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Hit end of string before finding the equals. %s: escape character at end of string %s: Skipping unknown attribute "%s" %s: No value provided for Subject Attribute %s, skipped Hostname %s does%s match certificate Email %s does%s match certificate IP %s does%s match certificate Can't read environment variable %s Can't access file descriptor %s Invalid password argument "%s" Error reading password from BIO bad input format specified for %s bad input format specified for input crl bad input format specified for key file %s: Can't open "%s" for writing, %s Error configuring OpenSSL modules LDIIIIIIIIIIIIIIIIIIIILIIIIIIILIIIIIDIIIIDIIIIIIIIIIIILIIIIIIILIIIIIDIIIID../apps/bf_prefix.cPrefix filter0xa hexadecimal0Xan octalparmoutfile+intulongPEM|DER|ENGINEPEM|DERuintmaxvalNSSnsspvkP12p12PKCS12%s: Unrecognized flag %s %s: Value must be one of: %s: Option -%s needs a value %s: Not a directory: %s %s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s (No additional info)%s %s PEM/DERmsblobhttp%s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number %s: Bad format "%s"; must be pem or der %s: Bad format "%s"; must be one of: %s: Value "%s" outside integer range %s: Option -%s does not take a value %s: Non-positive number "%s" for -%s %s: Invalid number "%s" for -%s %s: Invalid format "%s" for -%s %s: Option unknown option -%s %s: Internal error setting purpose %s Usage: %s [options] Valid options are: BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB8BBXBBBBBBB@B BBBBBBB(BBBBBBBB0BBBBBBBBBBBBBBBBBhBBBBBBpBBHBBPBBBBB`BDCCCCCCCCCCCCCCCCCCCDCCDCCCCCDCBCC`DCCCCCCCCCCCCCCCCCDCCDCCCCCDCBCC`DCKIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJIJJJIJIJIJIJIJIJLIJIJIJIJIJIJIJKIJIJIJIJIJIJIJIJIJIJIJIJIJJIJIJJIJIJIJIJIJ(LIJJIJJIJIJIJIJtKKLOOdO,O ONNN LNlNLN,N NMMMMlMLM,M MLLL\LK|LDLK----- RSA-PSSgost2001gost2012_512gost2012_256ECDSAprepend certSecurity callback: Version=%s%s=%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sNOT OKNOT OK %s: %s Suite B: not tested Shared Requested Signature Algorithms: +%s+0x%02Xdepth=%d verify error:num=%d:%s issuer= verify return:%d error setting certificate error setting private key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)groups to printSupported Elliptic Groups: 0x%04X../apps/s_cb.c Shared Elliptic groups: Server Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits SSL_connectSSL_acceptundefinedreadwriteSSL3 alert %s:%s:%s %s:failed in %s %s:error in %s >>><<<, warning, ???, fatal, ApplicationData, ChangeCipherSpec, Alert, Handshake%s %s%s [length %04lx]%s%s %02xmemory full Failed getting peer address assertion failed: length != 0cookie generate bufferMissing filename Server CertificateServer KeyServer Chain%s: Error adding xcert %s: Key already specified %s: Chain already specified matched TA certificatesigned the certificatematched EE certificate...Verification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefProtocol version: %s assertion failed: num == 2Client cipher list: Ciphersuite: %s Peer certificate: Hash used: %s Signature type: %s No peer certificate Error with command: "%s %s" Error with command: "%s" Error finishing context Error writing keylog file %s Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate TypeMD5SHA1SHA224SHA256SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512gostr34102001gostr34102012_256gostr34102012_512server namemax fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzcert typesupported_groupsEC point formatssignature algorithmsuse SRTPheartbeatsession ticketrenegotiation infosigned certificate timestampsTLS paddingnext protocolencrypt-then-macextended master secretkey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)RSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 Signs_cb.c:security_callback_debug op=0x%xKeylog callback is invoked without valid file! Checking cert chain %d: Subject: unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key error setting certificate chain error building certificate chain Supported Elliptic Curve Point Formats: read from %p [%p] (%lu bytes => %ld (0x%lX)) write to %p [%p] (%lu bytes => %ld (0x%lX)) TLS %s extension "%s" (id=%d), len=%d error setting random cookie secret %s: Error initialising xcert %s: %zu-byte buffer too large to hexencode DANE TLSA %d %d %d %s%s %s at depth %d # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names application layer protocol negotiation bad_certificate_status_responseJJLJJJJJJL$KJJL$KJJJJJJJJJJJJJJJJJJJJJJJJJJJJtLJJnKJJJJJJLLJJLLJJJJJJJJJJJJJJJJJJJJJJJJJJJJKJJtKJJJJJJCKIJJCKIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ]$^t^^^^]]unix IPv6 IPv4 ../apps/s_socket.cACCEPT %s:%s ACCEPT [%s]:%s ACCEPT assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res)); qPS p   дp @ H 0d 4Hp@XPpEPOUU,Zxphi,r`yy@pH00pH`0 0Lpx 40l` 040 P ` @ D` X tP d`P280 9t < `< =L!?!C "C`"E"YX#pY#]#@ip$@o$@r0%rD%P%%8&L&& &`\'`'p''@(P(Нd(()С)p*H*P*+0`++,D,`,,,p8-p--.`..P/ d//`I 0pI40IH0pKt0PO0p]1b\1h1pi1j82@mt2n20o 3o(3pt3Pq30s3s4`u\44(5d5P56P066 66 687`t777@(8`8`88 9X99`9:`L::::;@;;;;0<D<Px<<p<0=P=p=0= >`0>0L>h>>W? ]X?^?P`@a0@pa\@b@s(At\A zA0@B@TBBBЄCXC CDXDDpDPHEE`EEE Fp@FtF0FpFFF@F`4GlGGGH0@HPTHphHH H0H@HPHItIIHJ\J JPJJ8KpKPK@K4LpL@L` Mp M4M xMMM0@NtNNO@0ODO@OPOPP@Pp|PpPPQ (QDQXQlQQQ0Q$RpR R@R`RpR 4S hSp S` S ,T`lTTT0UDUXUU`U0V`tVV@WPW0xWpWWW X@ 4Xp `X@"X"XP#@6>mBEE A(D0M  0D(A BBBD 06@XBEA G  DBBE 47)BBE B(D0C8GP  8A0A(B BBBB bXH`^XAPc8C0A(B BBB>` >lKFs G CE>#D^<>AKJ X AAH ] FAD cFA\?,BDB B(A0A8DP_ 8F0A(B BBBB 8A0A(B BBB4t?МBED } BBL h JIM (?X{BBD lDBH?BDE B(K0D8D@f 8M0A(B BBBL H$@PBGI B(A0F8FPx 8M0A(B BBBI Lp@ԞVBEE A(C0s (D BBBC a (D BBBE p@BBA A(D0 (D ABBD \ (D DBBH d (D ABBK v (D ABBA 4A@HAL \AH@pADBBE D(D0J 0D(A BBBE @ABBE D(D0G 0A(A BBBG <ABBD D0P  DBBD X DBB@8BBEE A(A0J 0D(A BBBI 0|BBON ] DBF DBLBBBB E(D0D8G> 8D0A(B BBBK LC4BBB B(D0D8J  8A0A(B BBBJ PCԪAFelC3XC4BEB B(A0A8D`QhGpWhA`b 8D0A(B BBBH HC BEE B(A0C8G 8D0A(B BBBK ((D\wBLK O DBA $TD{BDD _HE8|DBDG  DBK h AEA TDKEE E(D0 (N IIDE A(B BBBGE ($EACFPE AAG PEdEkG^ A EDE@$E<$ADF VAA$ED$ADF VAAELP FXTBPA LT  DABF v  IHBG ^  KHBM ``FdBBE D(D0Q (A BBBG  (A JBBB A (C BBBF 0FTJD QEBFP F\ Gh D[$Gp48Gl$BFF p ABG Q CBB 0pGdVBND g DBG GDB0GpBAA D0  AABA (G̷AAD0w AAA `H;BBI E(G0A8DP 8I0A(B BBBJ i 8C0A(B BBBA <hHlBBB B(A0 (E BBBA 8HBBD D(F` (A ABBC @HPBBE A(A0FP 0D(A BBBH @(I0BBB A(A0DPV 0A(A BBBF lII`IBBB D(D0 (D BBBE K (L BBBK c (D BBBC <I BAD o DBD _ DBK QDB08J\VBND g DBG GDB@lJACD ^ FAC [ FAF l CAA LJpBBB E(A0A8Q 8D0A(B BBBK @KbBDB A(D0GL 0A(A BBBH DK0 XXK,BEE D(D0W (A EBBK [ (C BBBD a(A EBB$K<AAD sAA$K%BDF IIBL8Av$ L'BDG IJB$HL*BGG IGE(pL)BED UBB`LBEB E(D0D8D` 8A0A(B BBBH l 8J0A(B BBBI MtNALXMBBE D(D0c (L BBBJ Q (C BBBF v(A EBB xM !BQ E A O TMBIB D(A0Fp 0C(A BBBE t 0C(A BBBE MNlMA@ G (N0-M/TisP-m-p-t-z------p. p .!p@."-h.#<.$<.%<&&s.'s8/,(<p/A )s/4*-=Y+s/as ls0usX0s0s0> 1'sH1-ee -x3E -2]-2-2-2-2$-22-23 -3> -33s33 s4-FUJ H <oJ7FJ[>J _ Fx,| <Le -JJ -JJ -J-K/K -!K -;KLK -0LSK<hL9/L9<L9-D9-0DP-\Ky-LG -qKKsM-Kk_ -8M-FNN7FhN H < 7[>7N-N<N-f[7f[ H s[[>7 -[y -[ -[ \ -\\-\s\s]-: \ - ]+\-P]4\-=\'sPH-FNN H < 77FhN[>7y-#^8 -1^-?^I^ -P^s0> 1' sPH- H s 7fNN[>77FhN-[y-aa -b \ -\\ -\a-b- b s\ s]bsb)bs(c-:'sH1-Fi7FJ H <k[>ky-i8 -i-kl -(jl -Xj -l7 sj)b s(cbsbI^-4ls0> 1'sH1-n-n2-n H < 7[>7 sn -oV-oSk -o-!oee -;oJo -0q -Pono -uo-Pr# -Pql-oZ -qoso2\soo<oxso)soosp}sq@pr p-@r8\-p-:s0> 1'sH1-TZ - {{-|"{-|[>8|s0> 1\s]-w'sH17{p%{-|-| H < 7[>7-[>ˀ pH sۀ^ sp-]8- G -*D -M -[ -8# phR -g-Ȉ{----Hʁ-ց-LK-y-(--*sP0sxV<7<>Z<Ȋe<9<99 <09!-D9"-0Dr#uP$p%sx&s'sȋ9(s‚e )<ނ?*<^ +s,<#Z -<A.pF/p O0pXU1<ث2<]3<،d4sh5s@e 6sp-pO<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H- --ܐ---&-8R -h - -ב -ЗeR s- H <>]8-@-Wt-cz- s-˒ -x} -- -Ù - o -s0> 1- -'A-G`-gf8--- -0P -XH -ǝݝ - --sء-"-=-);-E]-cv-(z-s`ss0> 1:s<Þ7 s؞s s H <[>ˀ s\!s]:"s9#/9$<<9&-D9%-0D-:''sH1-FNN H < 77FhN[>7-գy-0-X -' sH1-F7F H < 7[>7ץ-ݥ"- -Ps0> 1ss.Isx@pOs\s]k-'sH1w -~ s sӦ sܦ-f7Fs\s] H s[[>7 \ -Ш\ -\  -y - -1-:k-0'sH1-F\-e- H < 7[>7y--'sH1-- H <oJ[>k \--(- $ -, -PP -<S -xce -p-Ю8-a-h}sp< :sիsHsݫE _ EpDyss0> 1'sH1.Q- JN<-f7f H s 7[>7 \-\\-\ s] s -,E -V-[y-[-p--: \- ]+\-P]4\ -=\'sH1- H < 7[>7:s[ _ Ep \--`" -- -- -P -<-$-, -ce -p-.8-Fss0> 1'sH1     -^ s p w ss# s)s) -.˒-<P pH? <p FK sM| Es _ >E ?s09A/J9H<g9I-D9B-0D^<X s s -F-'-8-!-">h(-)C)-IO8--^t-q-|Os s8s0> 1><SspTsUpWp" -07 Vsh <GW-dFl--8-`-%-&-2 @< C/HD/G-J< K< -0#PsX!Q-.-A -:Ns(EMspJR-P3s[XpiYpZp@[px - - - - ! -+@ -Ec -f -k - - - Ճ - -P - - - -@s< -x( s! s sHj sH3b sx: s3 s0 s= s@J spY -o -O<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H|<<< -@FxF7-6-5-$4-8- <-+=p/F9-L\:-dv-{b *s3+s,<(-s.s0-P1-/p+HLs'#sH1UsD: -Hg -l <v\>/ ]< --p@ ~s )s ) -.˒-<G -  sN P nH n ?<P K sMe p :s  F| s _ f  s0m <8 <s  Fp  <  F  s .-H O8>-1- 8-9>hC=- 9)<g9/J9*-D9 -0D -p ?-  B-  J-  K- #as   b-H  c<  d< .2-" L- ' `s0 s0> 1hsip<GW-2 <` 1 < !/ "/ = #-F \ $-8 d%Fl&-'-p (-+< ,<t/- q0-f A 3-~ 4-  5n  6s  7< ;-P <- @-`ce I- JM- PNs [OpiPpQp@Rpx - - - - ! -+@ -Ec -f -k - - - Ճ - -P - - - -@s< -x( s! s sHj sH3b sx: s3 s0 s= s@J spY -o -O<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H|<<< -@FxFv--{b Cs  Ds  3EsF<(% G<. H Hs@ W-T V-d U-v $T- X-  \- +]p  ^-h  _- FY- \Z-   A-& Hes gspEfs 'sH1j>@ knH ; ln / m-O j nn y o- v p-H -w sH :s3s?< KsM| < 9/J <g9 <g9 -D9 -0Dq -! P -; @-EPp L;p  s@ -Fi7f H soJ[>ky-s ?- -  s % ?@% @r% & & &  & )&  2& ;& D& M& V& ;_& h& q& z& & ;& & & & & & & &  6 3 / (  ! ' ' ' !' *' 3' <' E' N' W' `' i' r' {' ' ' ' ' ' ' ' ' ' ! ( ( ( ( )  ) ! ) ) Q} ~ ^~ $) .) 5) # $<T?) K) W)    l c) $l) r) - H < 7[>7| <p8 _ f8  s7 s7  s7 -8 6_ -xP-8 )8 s8 'sH1-2-.@ T<7 s= % <L@ -g@ @ -= @ -> n -@  s(> @ sX>  s\ s]s0> 1'sH1-r# -Q # -Q V-Q -R " -R P-R Sk-6R  -QR ee -mR d d d d d d d @d e e &e )e >e Re `e ge ``oe `ue `* 7@`{e e e e Ve e e e e e e e e e @e f f f %f ,f :f Ff Pf Zf -F H <[>(] p % p7<;P Yr pXy pu  ssu 8su -@Au -hAu -6-cA7cA H < 7[>7p-!78-17 -K7X7 -Ae7 -l7P -77 -7 <7-77-7-7-7-8-8-8-&8-<8-y-(BJ8-T8-PB]8-Bf8-Bn8-Bu8-~88-C8 -(C:!-88"-HC8#-8$-9%-8 9%-8 9&-9)9'-hC(-C19)-G9a9*-u9+-9,F9-<99.<99//C91-D90-0D92<xD3-D94s95s :6s:7s8s9s'::s2:;s?:V<sG:_:=<De:>>n:}?s E:@sXE _ AfEEyBsE:Cs:Ds-:s0> 1O<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H=E-==F-==G-=>H- >'IsPHu -PRu -pR-n-lP>J-R-R[>Rs syPPsSP s@S=} <P _ fhSo-P8-PV-P-PP-SQs QS sSisP-'QsS-Ks0> 1' sPH.Q - Tu -dUu -6- H < 7FU7FU[>7-Uy-Y -Ys0> 18 -Uz -Z} -PZU -Z'sPHu -tu -t-ee d-t"te-t!tf- u tg-Pu>J-pu -u%t-u(tsv,ts8vu hvu -vu -v-u -Pwu -6-[>pw\s]s0> 1-w'sH1-[>77Fx s]y<ys+yDyszLy -Uyy -ry -Pz'sH1u xzu -u --u -xu --o--;p)@-ȱOpEu -u -6-[>7s0> 1l-o-$'sH1u -0u -6-|8-&-`---ee -;o-FNN7FhN H < 7[ >7| sU _ fh6_ -xq-T < >s˸\s]s0> 1sDysisP-t--H- P-z-.-K2-;o-8+KsM]sdy- -pu s-̹!-+"p#s $s%s&sP'-(-K'sH1 su -@Au -hAu -6-p-!78-17 -K7P-7T -[ T8 -PB8-HC]8 -Bf8 -Bu8-~8n8 -B8-(C!<9VsG:_:<H H < 7cA:sXE _ fE[>77cA9<xDs':s2:s?:y-(B9/09"<99-D9-0De7-l7s -x 8-C9-8 9-8 9-9)9-hCs0> 1s}s E-:O<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H'sH1u -h3 u -6-S$ s3 8-3 U* -3 Z* -4 ]* -P4 # p`* {* pp4 s0> 1'sH1* -4 7{p4 p5 " p85 * ph5 u -D -[>ksy-E -A H -A N -A B -B  s*B e s@E ^ spE /KsE =^ s 1G sG D -G ? -G H < 7H - H [ >7#H --H y-EH iH -[H oH <yH s:sL VsG:H <H P-H 9/H 9<H H <I -K'sH1u -M O<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(Hu -u -@Au -6-2-@O 9/O 9<O 9-D9-0DH <O H <O 6N <O W -0P >N -pP KsMO<sE:s::s:;n;';nF2;M9;Q;sa;x;s;;s;;-8F;-;;-`F;-;<-(<F<-FV<-Fb<-Fn<-Gz<-<<-<<-@G<-<<-hG=-=.=-G9=-D=^=-Gl=-;z=-H=-(H'sH1-fT H <oJ7fT [>k _ Ep sT ^ -[\ \ #-u\ \ $-\ G #-\ %-\ e &-J;-\ *-\ +- ] :)-U 2] (-] -p6_ -8] /K'-8U =^ 4-N] 0-g]  =-~] ] 7-`U ] -] ] 1-] ] 2-] ^ 6-U ^ sU ^ sU $^ s-^  nV C^ ,MXV u L^ sc^ {^ !-V ^ -V Z <V ^ sW ^ 5-PW ^ s^ sy"-W sW 8 -^ , <W s0> 1 sW KsM^ sX ^ -s8X ^ .sXX ^ /sxX ^ F^ _ E_ isP-0_ <X =_ -X I_ 3-X LK:-8Y ;-KS_ 8-pY d_ 9-Y '<sH1t_ >-Y abb"b  D  o b  {VH`e ooHooo` 6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv  & 6 F V f v           & 6 F V f v           & 6 F V f v           & 6 F V f v           & 6 F V f v         &6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv&6FVfv  & 6 F V f v         !!&!6!F!V!f!v!!!!!!!!!""&"6"F"V"f"v"""""""""##&#6#F#V#f#v#########$$&$6$F$V$f$v$$$$$$$$$%%&%6%F%V%f%v%%%%%%%%%&&&&6&F&V&f&v&&&&&&&&&''&'6'F'V'f'v'''''''''((&(6(F(V(f(v((((((((())&)6)F)V)f)v)))))))))**&*6*F*V*f*v*********++&+6+F+V+f+v+++++++++,,&,6,F,V,f,v,,,,,,,,,--&-6-F-V-f-v---------..&.6.F.V.f.v.........//&/6/F/V/f/v/////////00&060F0V0f0v00000000011&161F1V1f1v11111111122&262u  3bAb?bLb3bAb?bLb7k 1 f@ 2М  m <@  @x z #  U x `   %b' '0?| K~ L`~ R` 'Y  n# .^ 3n@ 8P$ ?p`& @`* F+ "- L/ V@0 #   ^0# ^ 6 *\ 3 ec 5 l``8 u@H ~P@Y  IZ  N P@ p b > c    P)  / e @4 } ~ 6~ ^~ ’͒֒ߒ  $' 0' <' H' T' `' l' y' ' ' ' ' ' ɓ' ֓' ' ' '  ' ' &' 3' @' M' Z' g' u' ' ' ' ' ǔ' ؔ' l'  ' ' ' l' ' ' ' ' '  ' ' ' #' +' 7' D' L' X' e' m' y' ' ' ' ' ' ' ' •' ʕ' Օ' ' ' ' ' ' ' ' ' $' -' 5' =' E' M' asn1=SEQUENCE:LDAPMessage [LDAPMessage] messageID=INTEGER:1 extendedReq=EXPLICIT:23A,IMPLICIT:0C,FORMAT:ASCII,OCT:1.3.6.1.4.1.1466.20037 O uO uO uO v:Vx44Vx4Vx,xY4cO/<8?~%r 9캐[:Xl0B71jj )F˅ 0^9""4ah7=.J[HcӖd4ѠѮl/HC!0_ޣpx. }nBܷF6MF= btơu%]oO4~o0o٠]\ A2 ¢~h\(!XcLNKMX\Ug}n To@gL[<zgi @v&CV(_;i6,Qw/W{b;@{h 8!]F#rQFyٽ,W~={k&'jw,B҈ӒQd\lG %??! ]Te}ðhϛGjZ 7dy=a!t]LQG\LzrSxH:џ}G{tPVW+AV8F NDC!]n&1 !Ľ$PH,.I_W'6 +٘4PXTctvR{(JN؜y؛f/ϬyEx~"Qg&#8pMO@~rR332g蠋kE vϑMLoPF%ho0i](Hޙ?_ s$ ]*?'b{tbSa'z MTXItU~#Za~qM4)h^ lAsj~21lՅePfeo?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PI(1gPޛ~, Pa孽6N@} K}!ڻbG6g茪8a>ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR SP@1VSz"Iqi&+pSFbP3K$ ke8`$ԜLz"0!?܌`0&9>dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR,& ' ' ' (  ( ( !( +( 5( ?( I( S( ]( g( q( {( ( ( ( ( ( ( ( x) |) ) } ) ) ) ) ) ) ) ) ) ) ) ) * * S$ ~ ^~ $) 1* =* I* r) 07 UG J 8J J cG J J K PK K K cG K (L XL L n ?'n m yn m { { { { { { { { | 2| L| e| ~| | | | | | | } } -} :} G} @Y} k} } } 8\} } } } } } } OMu Ku } } } } ~ &~ =~ N~ e~ y~ ~ & ' ~ ~ ~ ~ ~ ~   , C S b q ~     D     #  , 8 t3F ` W n 3x +3) - / 1ŀ Ԁ     ) ? M a v     ́    C  ' : N ^ q   ( * +ւ , - . /( 04 1C 2Q 3` <t F G P VŃ Zԃ d m n o* p q= rY so t        Ƅ ӄ  @ A B  218d1c7cffdcb6ea8c18a88286a6f4339d418e.debugN.shstrtab.interp.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.data.bss.gnu_debuglink $& 4o> PFbNo [oHHjHH`etBVV{~y   R@2@222qDD | Ќ Ќ h h \   ` `  h* u E 5 ( 5 46